DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13978 and Enpp7

DIOPT Version :9

Sequence 1:NP_651562.2 Gene:CG13978 / 43303 FlyBaseID:FBgn0039518 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001012484.2 Gene:Enpp7 / 303729 RGDID:1359324 Length:439 Species:Rattus norvegicus


Alignment Length:244 Identity:53/244 - (21%)
Similarity:85/244 - (34%) Gaps:59/244 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RLVVFVTDGLRAATFLANNGSDV--PDLKDIYRQQGRIGISRTCAP---TMTRPGHIAIFAGFHE 106
            :|::...||.|     .|...||  |:| |...|:|  ..:|...|   |||.|.|..:..|.:.
  Rat    31 KLLLVSFDGFR-----WNYDQDVETPNL-DSMAQEG--VKARYMTPAFVTMTSPCHFTLVTGKYI 87

  Fly   107 DPAASLMHLCYNPGDFDTVFNRSRNMIGWAHSYIVGYFVKLSHGGAP---------LRFDSYMER 162
            :          |.|....:|..:.|.:...:...:|......:|..|         |:..|:.  
  Rat    88 E----------NHGVVHNMFYNTTNKVRLPYHATLGIQRWWDNGSIPIWITAQRQGLKTGSFF-- 140

  Fly   163 DLP--------EKLTCDKWAFDKVENFLRNVDNVREWRNYKPAVF-----------FVYLADMDI 208
             .|        |.:|     ..:.|..|.|..|..|||.....|.           .:|..:.|.
  Rat   141 -YPGGNVTYQGEAVT-----MSRKEGVLHNYKNETEWRANVDTVMKWFTEEDVSLVTLYFGEPDS 199

  Fly   209 AAHRFKPLSKKFFAKLQYTQRGIRNTYELFERVFNDSRTAYLMTSDHGM 257
            ..|::.|.|::....::...|.:....:..:|.........::||||||
  Rat   200 TGHKYGPESQERKDMVKQVDRTVGYLRDSIKRHHLTDSLNLIITSDHGM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13978NP_651562.2 GPI_EPT_1 42..328 CDD:293744 53/244 (22%)
PigN 414..839 CDD:282796
Enpp7NP_001012484.2 Enpp 30..395 CDD:293742 53/244 (22%)
Required for enzyme activity. /evidence=ECO:0000250|UniProtKB:Q6UWV6 71..77 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.