Sequence 1: | NP_651562.2 | Gene: | CG13978 / 43303 | FlyBaseID: | FBgn0039518 | Length: | 898 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036015136.1 | Gene: | Enpp2 / 18606 | MGIID: | 1321390 | Length: | 1001 | Species: | Mus musculus |
Alignment Length: | 456 | Identity: | 79/456 - (17%) |
---|---|---|---|
Similarity: | 123/456 - (26%) | Gaps: | 213/456 - (46%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 LEPPADRLVVFVTDGLRAATF------------LANNGSDVPDLKDIYRQQGRIGISRTCAPTMT 93
Fly 94 RPGHIAIFAGFHEDPAASLMHLCYNPGDFDTVFN------------------------------- 127
Fly 128 ----------RSRNMIGW----------------------AHSYIVGYF-VKLSHGGAPL----- 154
Fly 155 --------------------------RFDSYMERDLPEKL------------------------- 168
Fly 169 ---------------TCDKWAFDKVENFLRNVDNVR--------------EWRNYKPAVFFVYLA 204
Fly 205 DMDIAAHRFKPLSKKFFAK-LQY-TQRGIRNTYELFERVFNDSR---TAYLMTS-------DHGM 257
Fly 258 NNEGAHGSGSPLEVETPLFMWGAGVKRDEIDAEANFPEKPNISQVDQTQLAPLMSSLIGLPPPKN 322
Fly 323 N 323 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13978 | NP_651562.2 | GPI_EPT_1 | 42..328 | CDD:293744 | 79/455 (17%) |
PigN | 414..839 | CDD:282796 | |||
Enpp2 | XP_036015136.1 | SO | 118..159 | CDD:197571 | |
SO | 160..203 | CDD:197571 | |||
Phosphodiest | 227..591 | CDD:396300 | 65/382 (17%) | ||
NUC | 753..983 | CDD:214683 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1524 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |