DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side and sns

DIOPT Version :10

Sequence 1:NP_001247334.1 Gene:side / 43300 FlyBaseID:FBgn0016061 Length:986 Species:Drosophila melanogaster
Sequence 2:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster


Alignment Length:171 Identity:35/171 - (20%)
Similarity:55/171 - (32%) Gaps:44/171 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 LQDEARAIFNRTTIPDTFLEQLRTCTTQFVQWQTDVIESNIRFYRTSDPLEDQRLALFKQTILEI 399
            :.||.......||:| :|...:.|............:|...|    |:| |.|..|....:::::
  Fly   456 VDDEPATTSEVTTVP-SFSSPVTTIVPSQAATDLPAVEPTER----SEP-EQQPEATTGPSLIDL 514

  Fly   400 FFTQYHITPIRNNHRI-VHRAKVSEGLNINQKESRGTFNERTQLAAAADASVTETLRSLCDRLDH 463
            ......|..::|:..| .:|..:|.|             |.|.|.:.:.|..||....:.|.   
  Fly   515 LTPTTTIVAVQNDTIITTYRPALSSG-------------ETTTLVSESSADETEIQSRI
ADP--- 563

  Fly   464 LTLTRQLFHPQATLNDPLQEGDPDNGF-------APVQHRL 497
                          ||......|:||.       .|..|.|
  Fly   564 --------------NDGYNYEAPENGLTVPAGSSVPPSHTL 590

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
sideNP_001247334.1 V-set 95..211 CDD:462230
Ig 211..301 CDD:472250
Ig strand B 239..243 CDD:409353
Ig strand C 253..257 CDD:409353
Ig strand E 281..285 CDD:409353
Ig strand F 295..300 CDD:409353
Ig 326..408 CDD:472250 15/72 (21%)
Ig strand B 339..343 CDD:409353 0/3 (0%)
Ig strand C 353..357 CDD:409353 0/3 (0%)
Ig strand E 384..388 CDD:409353 1/3 (33%)
Ig strand F 396..401 CDD:409353 0/4 (0%)
Ig_2 442..511 CDD:464026 13/63 (21%)
FN3 <700..735 CDD:238020
snsNP_001036532.1 Ig 73..170 CDD:472250
Ig strand B 89..93 CDD:409559
Ig strand C 101..105 CDD:409559
Ig strand E 130..138 CDD:409559
Ig strand F 148..153 CDD:409559
Ig 173..279 CDD:472250
Ig strand B 196..200 CDD:409418
Ig strand C 210..214 CDD:409418
Ig strand E 241..245 CDD:409418
Ig strand F 255..260 CDD:409418
Ig strand G 272..275 CDD:409418
Ig_3 285..361 CDD:464046