DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side and Cadm1

DIOPT Version :10

Sequence 1:NP_001247334.1 Gene:side / 43300 FlyBaseID:FBgn0016061 Length:986 Species:Drosophila melanogaster
Sequence 2:NP_001012201.1 Gene:Cadm1 / 363058 RGDID:1310999 Length:476 Species:Rattus norvegicus


Alignment Length:382 Identity:88/382 - (23%)
Similarity:148/382 - (38%) Gaps:82/382 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 EGYELFLCCQVRGG--------RPPPKVTWWRD-----DT--ELIGTSHTSVEEGATVMVNQLLI 284
            ||....:.|||...        .|..:..::||     |:  :|:..|.:.::    |.:..:.|
  Rat    59 EGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELK----VSLTNVSI 119

  Fly   285 GTTTRDFYGIRIECRAQGTRLVDPVRKD-VTVQVYLKPVRVKIATPNELLTAGQPMPIRCESWGS 348
            ....|.|      |:.    ..||.::. .|:.|.:.|..:.|....:....|:.:.:.|.:..|
  Rat   120 SDEGRYF------CQL----YTDPPQESYTTITV
LVPPRNLMIDIQKDTAVEGEEIEVNCTAMAS 174

  Fly   349 YPAAKITWLLDGEPIR-NAEVTVHSDKEDGNITTSILTLKVTSENDNAELTCRATNPWFSGGAIE 412
            .||..|.|....:.:: .:||...||.   ...||.|.|||..|:|...:.|:..:|..:|. ::
  Rat   175 KPATTIRWFKGNKELKGKSEVEEWSDM---YTVTSQLMLKVHKEDDGVPVICQVEHPAVTGN-LQ 235

  Fly   413 DKRIIRVAYPPTVSVHLANEDPSRLVTRAEGQNVTFKCRADARPPVTSYSWFKNGMRM------S 471
            .:|.:.|.|.|.|.:.:..  |.:.:|| ||......|.|..:|.....:|.:....|      |
  Rat   236 TQRYLEVQYKPQVQIQMTY--PLQGLTR-EGDAFELTCEATGKPQPVMVTWVRVDDEMPQHAVLS 297

  Fly   472 GESTEIMHLTQLERESAGAYACGATNTEGETRSSSLTLKVQFSPRCKSGTEQTSIGAVSLHSILV 536
            |.:   :.:..|.:...|.|.|.|:||.|:..|..: |.|...|        |:|          
  Rat   298 GPN---LFINNLNKTDNGTYRCEASNTVGKAHSDYM-LYVYDPP--------TTI---------- 340

  Fly   537 KCEVDADPPDSVRFSWTYNNTRNVSPVLNSRIQSNGLAST------VTYLPQTDSEL 587
                   ||.:.. :.|...|...:.:|.  |.::..|:|      :|.||.:..||
  Rat   341 -------PPPTTT-TTTTTTTTTTTTILT--IITDTTATTEPAVHGLTQLPNSAEEL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sideNP_001247334.1 V-set 95..211 CDD:462230
Ig 211..301 CDD:472250 16/80 (20%)
Ig strand B 239..243 CDD:409353 0/3 (0%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 281..285 CDD:409353 0/3 (0%)
Ig strand F 295..300 CDD:409353 1/4 (25%)
Ig 326..408 CDD:472250 22/82 (27%)
Ig strand B 339..343 CDD:409353 0/3 (0%)
Ig strand C 353..357 CDD:409353 1/3 (33%)
Ig strand E 384..388 CDD:409353 2/3 (67%)
Ig strand F 396..401 CDD:409353 1/4 (25%)
Ig_2 442..511 CDD:464026 19/74 (26%)
FN3 <700..735 CDD:238020
Cadm1NP_001012201.1 IgV_1_Necl-2 50..143 CDD:409465 19/97 (20%)
FR1 50..68 CDD:409465 2/8 (25%)
Ig strand A 50..52 CDD:409465
Ig strand A' 53..59 CDD:409465 88/382 (23%)
Ig strand B 61..69 CDD:409465 1/7 (14%)
CDR1 69..74 CDD:409465 1/4 (25%)
FR2 75..82 CDD:409465 0/6 (0%)
Ig strand C 75..81 CDD:409465 0/5 (0%)
CDR2 83..94 CDD:409465 2/10 (20%)
Ig strand C' 85..89 CDD:409465 0/3 (0%)
Ig strand C' 91..94 CDD:409465 1/2 (50%)
FR3 95..130 CDD:409465 8/48 (17%)
Ig strand D 99..106 CDD:409465 1/6 (17%)
Ig strand E 109..115 CDD:409465 1/9 (11%)
Ig strand F 122..130 CDD:409465 3/17 (18%)
CDR3 131..134 CDD:409465 1/2 (50%)
Ig strand G 134..143 CDD:409465 1/8 (13%)
FR4 136..143 CDD:409465 1/6 (17%)
IgI_2_Necl-2 144..242 CDD:409466 25/101 (25%)
Ig strand A 144..147 CDD:409466 0/2 (0%)
Ig strand A' 150..154 CDD:409466 1/3 (33%)
Ig strand B 163..173 CDD:409466 1/9 (11%)
Ig strand C 176..185 CDD:409466 4/8 (50%)
Ig strand C' 186..189 CDD:409466 0/2 (0%)
Ig strand D 191..198 CDD:409466 2/6 (33%)
Ig strand E 201..211 CDD:409466 3/12 (25%)
Ig strand F 219..227 CDD:409466 1/7 (14%)
Ig strand G 234..241 CDD:409466 1/6 (17%)
IG_like 255..333 CDD:214653 22/82 (27%)
Ig strand B 266..270 CDD:409353 0/3 (0%)
Ig strand C 279..284 CDD:409353 0/4 (0%)
Ig strand F 313..318 CDD:409353 2/4 (50%)
4.1m 429..447 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.