DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42534 and AT4G03450

DIOPT Version :9

Sequence 1:NP_651560.2 Gene:CG42534 / 43298 FlyBaseID:FBgn0260487 Length:1555 Species:Drosophila melanogaster
Sequence 2:NP_192254.1 Gene:AT4G03450 / 827913 AraportID:AT4G03450 Length:641 Species:Arabidopsis thaliana


Alignment Length:435 Identity:109/435 - (25%)
Similarity:168/435 - (38%) Gaps:70/435 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 MYACQRGDIVQVLAQMR--EKPELLRQRDRSHRNALHYCAAQDSEGSKDLVAAASIAIAAPELLE 190
            :::..|...|:.|.:|:  ....|...|:.:....||..||.   |..:||  ..|....|.||.
plant    40 IFSAMRAGNVKFLDKMKTNNNTPLACFRNETGDFTLHLAAAW---GRLELV--KRIVSECPCLLL 99

  Fly   191 SADEDGFTPLHLAVIQGNLAMVNLLLANKADVNAV------------------DNEGHSVVHWAT 237
            ..:.....|||.|...|.||:|...:|.   ||.:                  |.:|::.:|.|.
plant   100 ETNSKDQIPLHAAAAAGRLAVVEAFVAR---VNEISDGLSEEERERVNLYAMKDIDGNTALHLAL 161

  Fly   238 VCGEVESLRAVLAAGASVAKPDAN--GGTPLHYA----------------AQMCG-ASKQDSKQQ 283
            ..|.::: .|.|.....:|...||  |.:||..|                .|.|. |||.:.::.
plant   162 KGGHLKT-AACLVKANHLASFLANNHGVSPLFTAIIAGSLTLVEAMMYVPGQTCNLASKLEGRKS 225

  Fly   284 ASSSNSSRLSLEILGILLSHPQSSVDVQDKDGRQPLLWAASAGSAKAVIALV-KAGARVESSDKD 347
            ...:.....:.:||.::||...|.|:.:|::||..|..||..|..|.|:.|: ::.:.|...|.|
plant   226 LVHAALKAKNSDILDVILSEDPSLVNERDEEGRTCLSVAAYVGYYKGVVNLLHRSTSNVFECDDD 290

  Fly   348 GLTALHCAGSRGHTECIDTLIGLCGAPTDLIDSNGCTALHYAVTLGHADA----TARLLDLEADP 408
            |...:|.|..:|..:....|:..|.....|::..|...||.|...|....    ..:..||..:.
plant   291 GSYPIHMAVEKGRVKIFLKLLKCCPDSQYLLNKQGQNILHIAAKSGKTGTYLLQVIKAYDLIKND 355

  Fly   409 --NRQDRKGRTPAHCGCSKGQFETLKLLKE--RGANLWLRNAKGDLPLHEAAASG---------R 460
              ..||..|.||.|......:..|:.:|.:  .|.:|.:||..| |...:.|.|.         |
plant   356 LIMEQDVDGNTPLHLATLTWRPRTVNILNKFTLGNHLHIRNKDG-LSALDIAESNLQSNYVFRER 419

  Fly   461 RELLEWLLAQRP---KQVNTTSNDGRSLLHIAAANDYTDMCKLLL 502
            ..|:..|....|   |.:.|:....:|.....|.|.|.|...:||
plant   420 MTLMVLLCTCSPRGFKMIPTSGITLKSRSEKVAGNKYKDSINVLL 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42534NP_651560.2 Ank_2 127..226 CDD:289560 28/117 (24%)
ANK 193..335 CDD:238125 45/178 (25%)
ANK repeat 195..226 CDD:293786 11/48 (23%)
Ank_5 214..269 CDD:290568 16/74 (22%)
ANK repeat 228..259 CDD:293786 7/30 (23%)
ANK repeat 314..345 CDD:293786 10/31 (32%)
Ank_2 319..412 CDD:289560 24/99 (24%)
ANK 345..468 CDD:238125 34/139 (24%)
ANK repeat 347..379 CDD:293786 8/31 (26%)
ANK repeat 381..412 CDD:293786 7/36 (19%)
ANK 409..538 CDD:238125 29/108 (27%)
ANK repeat 414..479 CDD:293786 20/78 (26%)
ANK repeat 419..445 CDD:293786 5/27 (19%)
Ank_2 420..511 CDD:289560 24/97 (25%)
ANK repeat 481..511 CDD:293786 7/22 (32%)
Ank_2 486..>545 CDD:289560 6/17 (35%)
ANK repeat 516..542 CDD:293786
AT4G03450NP_192254.1 ANK 67..207 CDD:238125 37/148 (25%)
Ank_2 75..176 CDD:289560 29/109 (27%)
ANK repeat 75..102 CDD:293786 11/31 (35%)
ANK repeat 104..150 CDD:293786 11/48 (23%)
ANK 148..311 CDD:238125 42/163 (26%)
Ank_2 <149..207 CDD:289560 14/58 (24%)
ANK repeat 152..184 CDD:293786 7/32 (22%)
Ank_2 228..316 CDD:289560 25/87 (29%)
ANK 251..383 CDD:238125 34/131 (26%)
ANK repeat 256..288 CDD:293786 10/31 (32%)
Ank_2 295..383 CDD:289560 20/87 (23%)
ANK repeat 324..361 CDD:293786 7/36 (19%)
PGG 455..564 CDD:290670 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X100
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.