DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42534 and ACD6

DIOPT Version :9

Sequence 1:NP_651560.2 Gene:CG42534 / 43298 FlyBaseID:FBgn0260487 Length:1555 Species:Drosophila melanogaster
Sequence 2:NP_567430.1 Gene:ACD6 / 827085 AraportID:AT4G14400 Length:670 Species:Arabidopsis thaliana


Alignment Length:402 Identity:106/402 - (26%)
Similarity:170/402 - (42%) Gaps:51/402 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VIAMPGSSQDTDAAAEAAVDVPETDPDPAQLTVSQSQSSST-VARRRLAEGCTSLMYACQRGDIV 137
            :.|:||  :|.:...|....:...:.:    .:.:.:|:.| :.|.:...|.:.|..|.:.|.:.
plant    57 LFALPG--EDVEMTPEIFGGMSNGEKE----CLEKLRSNGTPMERVKSNTGDSILHIAAKWGHLE 115

  Fly   138 QVLAQMREKPELLRQRDRSHRNALHYCA-AQDSEGSKDLVAAASIAIAA----------PELLES 191
            .|...:.|.|.||.:::.|.:..||... ...::..:.|||:.:.|:|:          |.:|: 
plant   116 LVKEIIFECPCLLFEQNSSRQTPLHVATHGGHTKVVEALVASVTSALASLSTEESEGLNPHVLK- 179

  Fly   192 ADEDGFTPLHLAVIQGNLAMVNLLLANKADVNAV---DNEGHSVVHWATVCG-EVESL-RAVLAA 251
             ||||.|.|:.|:....|.|...|:  .||.:|.   :|:|.|.::.|...| :.|.| :|:|..
plant   180 -DEDGNTALYYAIEGRYLEMATCLV--NADKDAPFLGNNKGISSLYEAVDAGNKFEDLVKAILKT 241

  Fly   252 GASVAKPDANGGTPLHYAAQMCGASKQDSKQQASSSNS----SRLSLEILGILLSHPQSSVDVQD 312
                  .|.|....:.       ....|||.|.:...:    ...|:.:|.::|....|.:|.||
plant   242 ------TDDNVDREVR-------KFNLDSKLQGNKHLAHVALKAKSIGVLDVILDEYPSLMDEQD 293

  Fly   313 KDGRQPLLWAASAGSAKAVIALVKAGAR-VESSDKDGLTALHCAGSRGHTECIDTLIGLCGAPTD 376
            :|||..|.:.||.|..|.:..::....: |...|:||...:|.|....|.|.|...|..|.|...
plant   294 EDGRTCLSYGASIGYYKGLCNILNRSTKGVYVCDQDGSFPIHSAAKNEHYEIIKEFIKRCPASKY 358

  Fly   377 LIDSNGCTALHYAVTLGHADATARLLDLEADPNR----QDRKGRTPAHCGCSKGQFETLKLLKER 437
            |::..|...||.|.. ..|..||.:|..:.|...    ||..|.||.|.......|:::..|..|
plant   359 LLNRLGQNILHVAAK-NEASLTAYMLMHDKDTKHLGVGQDVDGNTPLHLAVMNWDFDSITCLASR 422

  Fly   438 GAN-LWLRNAKG 448
            ... |.|||..|
plant   423 NHEILKLRNKSG 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42534NP_651560.2 Ank_2 127..226 CDD:289560 31/112 (28%)
ANK 193..335 CDD:238125 43/150 (29%)
ANK repeat 195..226 CDD:293786 11/33 (33%)
Ank_5 214..269 CDD:290568 15/59 (25%)
ANK repeat 228..259 CDD:293786 8/32 (25%)
ANK repeat 314..345 CDD:293786 9/31 (29%)
Ank_2 319..412 CDD:289560 27/97 (28%)
ANK 345..468 CDD:238125 35/109 (32%)
ANK repeat 347..379 CDD:293786 11/31 (35%)
ANK repeat 381..412 CDD:293786 9/34 (26%)
ANK 409..538 CDD:238125 14/45 (31%)
ANK repeat 414..479 CDD:293786 12/36 (33%)
ANK repeat 419..445 CDD:293786 6/26 (23%)
Ank_2 420..511 CDD:289560 9/30 (30%)
ANK repeat 481..511 CDD:293786
Ank_2 486..>545 CDD:289560
ANK repeat 516..542 CDD:293786
ACD6NP_567430.1 ANK 97..239 CDD:238125 40/145 (28%)
ANK repeat 101..132 CDD:293786 9/30 (30%)
Ank_2 105..208 CDD:289560 30/106 (28%)
ANK repeat 134..180 CDD:293786 10/47 (21%)
ANK repeat 182..209 CDD:293786 10/28 (36%)
Ank_2 267..352 CDD:289560 25/84 (30%)
ANK 290..419 CDD:238125 40/129 (31%)
ANK repeat 329..361 CDD:293786 11/31 (35%)
Ank_2 334..426 CDD:289560 27/92 (29%)
ANK repeat 363..397 CDD:293786 9/34 (26%)
PGG 506..594 CDD:290670
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X100
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.