DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42534 and MIB1

DIOPT Version :9

Sequence 1:NP_651560.2 Gene:CG42534 / 43298 FlyBaseID:FBgn0260487 Length:1555 Species:Drosophila melanogaster
Sequence 2:NP_065825.1 Gene:MIB1 / 57534 HGNCID:21086 Length:1006 Species:Homo sapiens


Alignment Length:765 Identity:173/765 - (22%)
Similarity:277/765 - (36%) Gaps:216/765 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 DPAQLTVSQSQSSSTVARRRLAEGCTSLMYACQRGDIVQVLAQMREKPELLRQRDRSHRNAL--- 161
            :||.||.:....|...|:.  |||.||..   |.||:|||...: |:.:||::.......|:   
Human   307 NPAVLTKANIVRSGDAAQG--AEGGTSQF---QVGDLVQVCYDL-ERIKLLQRGHGEWAEAMLPT 365

  Fly   162 ------------------HYC-------------------AAQDSEG------------------ 171
                              ..|                   |..::.|                  
Human   366 LGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVASAGSAISNASGERLSQLLKKLFETQESGD 430

  Fly   172 -SKDLVAAASIAIAA--PELLESADED------GFTPLHLAVIQGNLAMVNLLLANKADVNAVDN 227
             :::||.||:....|  .:||:..|.|      |.|.:..|...|::.::.|||....||.|.|.
Human   431 LNEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDK 495

  Fly   228 EGHSVVHWATVCGEVESLRAVLAAGASVAKPDANG-----GTPLHYAAQMCGASKQDSKQQASSS 287
            :|...||.|.. |:..::..||..|::    |.|.     .||||.|.                 
Human   496 DGDRAVHHAAF-GDEGAVIEVLHRGSA----DLNARNKRRQTPLHIAV----------------- 538

  Fly   288 NSSRLSLEILGILLS---HPQSSVDVQDKDGRQPLLWAASAGSAKAVIALVKAGARVESSDKDGL 349
              ::..|:::..||.   ||    .:||.:|..||..|.|......:..|::|||.|..::.:|.
Human   539 --NKGHLQVVKTLLDFGCHP----SLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGF 597

  Fly   350 TALHCAGSRGHTECIDTLIGLCGAP--TDLIDSNGCTALHYAVTLGHADATARLLDLEADPNR-- 410
            .|||.|..||:...:..|:.....|  .|....:|.||||.|....|.: .|.||..:.:.|.  
Human   598 NALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVE-VAELLVHQGNANLDI 661

  Fly   411 QDRKGRTPAHCGCSKGQFETLKLLKERGANLWLRNAKGDLPLHEAAASGRRELLEWLLAQRPKQV 475
            |:...:|..|....:...:.::||...||.|.:::..||.|||||...                 
Human   662 QNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRH----------------- 709

  Fly   476 NTTSNDGRSLLHIAAANDYTDMCKLLLDYGADVNAVYRNSRGLVLTPL--DGALQRGHRSTAKFL 538
                   .:|..:....|..|:.|        |:|.:..|:..::..|  .||.::...|.|.||
Human   710 -------HTLSQLRQLQDMQDVGK--------VDAAWEPSKNTLIMGLGTQGAEKKSAASIACFL 759

  Fly   539 QANGGQPANKVRLSSRRTGNPFHETNATDMVRPLKYVEKEELHDLRSSKKYVVYLKRSDSDNGNE 603
            .|||..    :.:.:::..:|.......::.:.|....||::.....|:.  ..:..:||:...|
Human   760 AANGAD----LSIRNKKGQSPLDLCPDPNLCKALAKCHKEKVSGQVGSRS--PSMISNDSETLEE 818

  Fly   604 -----NGKADVGDGDC----SCSEQTYRKEQRLRHVCRRHKRRQLRRRTS-----SCGESK---- 650
                 :.|.|...|.|    :||..:.|.::.|  :|    :.|::.||.     .|.:.|    
Human   819 CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCL--IC----KEQVQSRTKIEECVVCSDKKAAVL 877

  Fly   651 HERCSEICRSKSNIEIRRRKSRERYASSSEWEEESAEDSCENCC--YHKRQKDRVVNRKRSTSSR 713
            .:.|..:|                              :||||.  ..|..:.|.|..:|.....
Human   878 FQPCGHMC------------------------------ACENCANLMKKCVQCRAVVERRVPFIM 912

  Fly   714 KSKNRDSSDPDEKNHSENHSSPEKGSRKPLAVNGD-----HQADNGKDQT 758
            ....:.|.|..:...|.|....:| .:....||.|     .|..:.|:||
Human   913 CCGGKSSEDATDDISSGNIPVLQK-DKDNTNVNADVQKLQQQLQDIKEQT 961

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42534NP_651560.2 Ank_2 127..226 CDD:289560 32/165 (19%)
ANK 193..335 CDD:238125 40/155 (26%)
ANK repeat 195..226 CDD:293786 11/36 (31%)
Ank_5 214..269 CDD:290568 21/59 (36%)
ANK repeat 228..259 CDD:293786 8/30 (27%)
ANK repeat 314..345 CDD:293786 10/30 (33%)
Ank_2 319..412 CDD:289560 29/96 (30%)
ANK 345..468 CDD:238125 36/126 (29%)
ANK repeat 347..379 CDD:293786 10/33 (30%)
ANK repeat 381..412 CDD:293786 11/32 (34%)
ANK 409..538 CDD:238125 28/132 (21%)
ANK repeat 414..479 CDD:293786 14/64 (22%)
ANK repeat 419..445 CDD:293786 6/25 (24%)
Ank_2 420..511 CDD:289560 18/90 (20%)
ANK repeat 481..511 CDD:293786 5/29 (17%)
Ank_2 486..>545 CDD:289560 16/60 (27%)
ANK repeat 516..542 CDD:293786 8/27 (30%)
MIB1NP_065825.1 MIB_HERC2 15..72 CDD:399589
ZZ_Mind_bomb 83..127 CDD:239079
MIB_HERC2 154..218 CDD:399589
SH3_15 246..311 CDD:408152 2/3 (67%)
SH3_15 333..397 CDD:408152 11/67 (16%)
ANK 1 430..460 9/29 (31%)
PHA03095 439..>710 CDD:222980 85/323 (26%)
ANK 2 463..492 9/28 (32%)
ANK repeat 464..494 CDD:293786 10/29 (34%)
ANK repeat 496..560 CDD:293786 20/91 (22%)
ANK 3 496..525 9/33 (27%)
ANK 4 529..558 10/51 (20%)
ANK repeat 562..593 CDD:293786 10/30 (33%)
ANK 5 562..591 10/28 (36%)
ANK 6 595..627 9/31 (29%)
ANK repeat 631..663 CDD:293786 11/32 (34%)
ANK 7 631..661 11/30 (37%)
ANK repeat 665..696 CDD:293786 7/30 (23%)
ANK 8 665..694 7/28 (25%)
Ank_2 670..770 CDD:403870 30/135 (22%)
ANK 9 698..729 12/62 (19%)
RING1-HC_MIB1 818..854 CDD:319638 10/41 (24%)
RING2-HC_MIB1 865..901 CDD:319639 9/65 (14%)
RING3-HC_MIB1 962..1003 CDD:319641 173/765 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X100
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.