DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42534 and nfkb1

DIOPT Version :9

Sequence 1:NP_651560.2 Gene:CG42534 / 43298 FlyBaseID:FBgn0260487 Length:1555 Species:Drosophila melanogaster
Sequence 2:XP_021336944.1 Gene:nfkb1 / 565756 ZFINID:ZDB-GENE-121204-3 Length:539 Species:Danio rerio


Alignment Length:475 Identity:88/475 - (18%)
Similarity:143/475 - (30%) Gaps:158/475 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 RPKQVNTTSNDGRSLLHIAAANDYTDMCKLL-----------LDYGADVNAVYRNSRGLVLTPLD 524
            :||. ::.|.....:||:...|    :.|:|           .:||..::......:|.|..|.:
Zfish   138 QPKD-SSISFPNLGILHVTKKN----VSKVLEERMMEAYRMGYNYGIFIHPEIDALQGEVRMPRE 197

  Fly   525 GALQRGHRSTAKFLQANGGQPANKVRLS-SRRTGNPFHETNATDMVRPLKYVEKEELHDLRSSKK 588
              |....||   .:.:...|.|.::.|| .|.....|...:.....|.|:.|..|.::|.::...
Zfish   198 --LNEAERS---LISSAASQQAKEMDLSVVRLMFTAFLPDSDGGFSRRLEPVISEPIYDSKAPNA 257

  Fly   589 YVVYLKRSDSDNGNENGKADVGDGDCSCSEQTYRKEQRLRHVCRRHKRRQLRRRTSSC---GESK 650
            ..:.:.|.|                                            ||:.|   ||..
Zfish   258 SNLKIVRMD--------------------------------------------RTAGCVTGGEEV 278

  Fly   651 HERCSEICRSKSNIEIRRRKSRERYASSSEWE---EESAED-SCENCCYHKRQKDRVVNRKRSTS 711
            :..|.::  .|.:|::|..:.     ..|.||   :.|..| ..:.....|..|.|.:|.::..|
Zfish   279 YLLCDKV--QKDDIQVRFYED-----DDSGWEAYGDFSPTDVHRQFAIVFKTPKYRDLNLQKPIS 336

  Fly   712 -----SRKSKNRDSSDPDEKNHSENHSSPEKGSRKPL-----------AVNGDHQADNGKDQTST 760
                 .|||.| ::|:|....:.......|:..||..           |..|......|....||
Zfish   337 VFVQLKRKSDN-ETSEPKPFTYHPQIIDKEEVQRKRQKTLPNFQDYSGAGGGAGGMFRGGGGGST 400

  Fly   761 KERPPSAS----------------------RHQTPPTKEGTFIKSPTQSAKSEKSGQMDNLLVEE 803
            ....||..                      ...:.....||.||...|....:..|:.|:     
Zfish   401 AGGGPSGGGGGGGGHFFHGYQNFNNFGSGYSFSSAMGGGGTNIKHAHQEPVEDSEGEDDD----- 460

  Fly   804 SHAVELTDEEQEAAKSVVTQVDVHH-----DAEEIQTSKSSEEAPQAEENGKEKESEQEVKLQLS 863
                   |::.:.|...|.|:..|.     .||::..| .|..||...|                
Zfish   461 -------DDDDDPAAGGVVQLSDHPGFTGVKAEDLHAS-GSVLAPHLAE---------------- 501

  Fly   864 EEETQLVSKEVEQVIIIAAT 883
                 |.|::.|.:...|.|
Zfish   502 -----LASRQAEALFHYAVT 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42534NP_651560.2 Ank_2 127..226 CDD:289560
ANK 193..335 CDD:238125
ANK repeat 195..226 CDD:293786
Ank_5 214..269 CDD:290568
ANK repeat 228..259 CDD:293786
ANK repeat 314..345 CDD:293786
Ank_2 319..412 CDD:289560
ANK 345..468 CDD:238125
ANK repeat 347..379 CDD:293786
ANK repeat 381..412 CDD:293786
ANK 409..538 CDD:238125 16/77 (21%)
ANK repeat 414..479 CDD:293786 2/7 (29%)
ANK repeat 419..445 CDD:293786
Ank_2 420..511 CDD:289560 10/50 (20%)
ANK repeat 481..511 CDD:293786 7/40 (18%)
Ank_2 486..>545 CDD:289560 13/69 (19%)
ANK repeat 516..542 CDD:293786 6/25 (24%)
nfkb1XP_021336944.1 RHD-n 52..253 CDD:298664 27/124 (22%)
IPT_NFkappaB 260..359 CDD:238582 27/150 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X100
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.