DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42534 and ANKRD16

DIOPT Version :9

Sequence 1:NP_651560.2 Gene:CG42534 / 43298 FlyBaseID:FBgn0260487 Length:1555 Species:Drosophila melanogaster
Sequence 2:NP_001009941.1 Gene:ANKRD16 / 54522 HGNCID:23471 Length:361 Species:Homo sapiens


Alignment Length:398 Identity:105/398 - (26%)
Similarity:163/398 - (40%) Gaps:54/398 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 DPAQL--TVSQSQSSSTVARRRLAEGC-----TSLMYACQRGDIVQVLAQMREKPEL-LRQRDRS 156
            ||.:|  .|.:.:..:.....:.|.||     .:|::...|.....|||.:.|...: :...:|.
Human     6 DPRRLCRLVQEGRLRALKEELQAAGGCPGPAGDTLLHCAARHGHRDVLAYLAEAWGMDIEATNRD 70

  Fly   157 HRNALHYCAAQDSEGSKDLVAAASIAIAAPELLESADEDGFTPLHLAVIQGNLAMVNLLLANKAD 221
            ::..||..|   |.|.:|.|.......||.:.|:.||   :|||.:|..:.||.::..|:.:.|:
Human    71 YKRPLHEAA---SMGHRDCVRYLLGRGAAVDCLKKAD---WTPLMMACTRKNLGVIQELVEHGAN 129

  Fly   222 VNAVDNEGHSVVHWATVCGEVESLRAVLAAGASVAKPDAN-GGTPLHYAAQMCGASKQDSKQQAS 285
            ....:.:|.:..|.|:..|:...|:.:|.......|.::. ..||||.|| |.|           
Human   130 PLLKNKDGWNSFHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAA-MHG----------- 182

  Fly   286 SSNSSRLSLEILGILLSHPQSSVDVQDKDGRQPLLWAASAGSAK-AVIALVKAGARVESSDKDGL 349
                   .||.:.:||...|...|.:|..|...|:.|...|... |.:.|.:.||.:.:.|..|.
Human   183 -------HLEAVKVLLKRCQYEPDYRDNCGVTALMDAIQCGHIDVARLLLDEHGACLSAEDSLGA 240

  Fly   350 TALHCAGSRGHTECIDTLIGLCGAPTDL-IDSNGCTALHYAVTLGHADATARLLDLEADPNRQDR 413
            .|||.|...|..|.|..|:...|...|: ..|...||||||...||......||.|.||.|.:|.
Human   241 QALHRAAVTGQDEAIRFLVSELGVDVDVRATSTHLTALHYAAKEGHTSTIQTLLSLGADINSKDE 305

  Fly   414 KGRTPAHCGCSKGQFETLKLLKERGANLWLRNAKGDLPLHEAAASGRRELLEWLLAQRPKQVNTT 478
            |.|:..|..|:.......|.|.:.|    |::::              ::...|..|.|::.:..
Human   306 KNRSALHLACAGQHLACAKFLLQSG----LKDSE--------------DITGTLAQQLPRRADVL 352

  Fly   479 SNDGRSLL 486
            ...|.|.:
Human   353 QGSGHSAM 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42534NP_651560.2 Ank_2 127..226 CDD:289560 27/99 (27%)
ANK 193..335 CDD:238125 36/143 (25%)
ANK repeat 195..226 CDD:293786 8/30 (27%)
Ank_5 214..269 CDD:290568 13/55 (24%)
ANK repeat 228..259 CDD:293786 7/30 (23%)
ANK repeat 314..345 CDD:293786 8/31 (26%)
Ank_2 319..412 CDD:289560 34/94 (36%)
ANK 345..468 CDD:238125 36/123 (29%)
ANK repeat 347..379 CDD:293786 11/32 (34%)
ANK repeat 381..412 CDD:293786 14/30 (47%)
ANK 409..538 CDD:238125 15/78 (19%)
ANK repeat 414..479 CDD:293786 11/64 (17%)
ANK repeat 419..445 CDD:293786 6/25 (24%)
Ank_2 420..511 CDD:289560 11/67 (16%)
ANK repeat 481..511 CDD:293786 2/6 (33%)
Ank_2 486..>545 CDD:289560 0/1 (0%)
ANK repeat 516..542 CDD:293786
ANKRD16NP_001009941.1 Ank_2 10..95 CDD:372319 19/87 (22%)
ANK 1 36..66 6/29 (21%)
ANK repeat 37..68 CDD:293786 6/30 (20%)
ANK repeat 70..101 CDD:293786 9/33 (27%)
ANK 2 70..99 9/31 (29%)
PHA02875 75..>301 CDD:165206 76/250 (30%)
ANK repeat 103..134 CDD:293786 10/33 (30%)
ANK 3 103..132 10/31 (32%)
ANK 4 136..165 6/28 (21%)
ANK 5 170..200 13/48 (27%)
ANK repeat 172..202 CDD:293786 14/48 (29%)
Ank_2 175..304 CDD:372319 48/147 (33%)
ANK repeat 204..236 CDD:293786 8/31 (26%)
ANK 6 204..234 8/29 (28%)
ANK repeat 238..269 CDD:293786 11/30 (37%)
ANK 7 238..268 10/29 (34%)
ANK repeat 272..304 CDD:293786 15/31 (48%)
ANK 8 273..302 13/28 (46%)
Ank_2 278..>340 CDD:372319 21/79 (27%)
ANK 9 306..335 8/32 (25%)
ANK repeat 306..330 CDD:293786 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X100
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.