| Sequence 1: | NP_651560.2 | Gene: | CG42534 / 43298 | FlyBaseID: | FBgn0260487 | Length: | 1555 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001002578.1 | Gene: | ankrd54 / 436851 | ZFINID: | ZDB-GENE-040718-318 | Length: | 315 | Species: | Danio rerio |
| Alignment Length: | 282 | Identity: | 68/282 - (24%) |
|---|---|---|---|
| Similarity: | 104/282 - (36%) | Gaps: | 76/282 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 69 EAADKVIAMPGSSQDTDAAAEAAVDVPETDPDPAQLTVSQSQSSSTVARRR-----LAEGCTSLM 128
Fly 129 YACQRGDIVQVLAQMREKP----------------ELL---------------RQRDRSHRNALH 162
Fly 163 YCAAQDSEGSKDLVAAASIAIAA--------PELLE------SADEDGFTPLHLAVIQGNLAMVN 213
Fly 214 LLLANKADVNAVDNEGHSVVHWATVCGEVESLRAVLAAGASVAKPDANGGTPLHYAAQMCGASKQ 278
Fly 279 DSKQQASSSNSSRLSLEILGIL 300 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42534 | NP_651560.2 | Ank_2 | 127..226 | CDD:289560 | 36/143 (25%) |
| ANK | 193..335 | CDD:238125 | 37/108 (34%) | ||
| ANK repeat | 195..226 | CDD:293786 | 13/30 (43%) | ||
| Ank_5 | 214..269 | CDD:290568 | 21/54 (39%) | ||
| ANK repeat | 228..259 | CDD:293786 | 8/30 (27%) | ||
| ANK repeat | 314..345 | CDD:293786 | |||
| Ank_2 | 319..412 | CDD:289560 | |||
| ANK | 345..468 | CDD:238125 | |||
| ANK repeat | 347..379 | CDD:293786 | |||
| ANK repeat | 381..412 | CDD:293786 | |||
| ANK | 409..538 | CDD:238125 | |||
| ANK repeat | 414..479 | CDD:293786 | |||
| ANK repeat | 419..445 | CDD:293786 | |||
| Ank_2 | 420..511 | CDD:289560 | |||
| ANK repeat | 481..511 | CDD:293786 | |||
| Ank_2 | 486..>545 | CDD:289560 | |||
| ANK repeat | 516..542 | CDD:293786 | |||
| ankrd54 | NP_001002578.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..49 | 8/59 (14%) | |
| ANK 1 | 124..153 | 6/28 (21%) | |||
| ANK | 129..237 | CDD:238125 | 38/112 (34%) | ||
| Ank_2 | 129..221 | CDD:289560 | 29/91 (32%) | ||
| ANK repeat | 129..155 | CDD:293786 | 5/25 (20%) | ||
| ANK repeat | 157..188 | CDD:293786 | 13/30 (43%) | ||
| ANK 2 | 157..186 | 12/28 (43%) | |||
| ANK repeat | 190..221 | CDD:293786 | 8/30 (27%) | ||
| ANK 3 | 190..219 | 8/28 (29%) | |||
| BAR | 216..>291 | CDD:299863 | 15/47 (32%) | ||
| ANK 4 | 223..255 | 12/36 (33%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||