DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42534 and Gasz

DIOPT Version :9

Sequence 1:NP_651560.2 Gene:CG42534 / 43298 FlyBaseID:FBgn0260487 Length:1555 Species:Drosophila melanogaster
Sequence 2:NP_610362.1 Gene:Gasz / 35795 FlyBaseID:FBgn0033273 Length:461 Species:Drosophila melanogaster


Alignment Length:303 Identity:68/303 - (22%)
Similarity:101/303 - (33%) Gaps:120/303 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 AIAAPELLESADEDGFTPLHLAVIQGNLAMVNLLLANKADVNAVDNEGH-SVVHW------ATVC 239
            |:.|.:|....:|  ...|.|.|.|.....:|||:       ....||| .:|.|      |.|.
  Fly    47 AVVAGDLKTMQEE--MRKLVLQVDQPVKGGLNLLM-------LACREGHYKIVEWLLERAGANVN 102

  Fly   240 GEVESLRAVLAAGASVAKPDANGGTPLHYAAQMCGASKQDSKQQASSSNSSRLSLEILGILLSHP 304
            .:::||..::.|                     |..:.:|          ..|:..|:|:||.| 
  Fly   103 RQLDSLMPLMMA---------------------CNTTHKD----------PCLAERIVGLLLRH- 135

  Fly   305 QSSVDVQDKDGRQPLLWAASAGSAKAVIALVKAGARVESSDKDGLTALHCAGSRGHTECIDTLIG 369
            .:.::|.:|.|..|.::|...|.|..|..|:|                                 
  Fly   136 GAVINVSEKYGMTPFMFACQNGFAGVVRLLIK--------------------------------- 167

  Fly   370 LCGAPTDLIDSNGCTALHYAVTLGHADATARLLDLEADPNRQDRKGRTPAHCGCSKGQFETLKLL 434
              .|..|.:|:.||||:.:|:...|.                                 |.:|||
  Fly   168 --DASFDAVDNQGCTAIFHAIEKNHV---------------------------------EVVKLL 197

  Fly   435 KERGANLWLRNAKGDLPLHEAAASGRRELLEWLLAQRPKQVNT 477
            .|.|||..:.|.||..|...|...|..:|||.|    |:..:|
  Fly   198 VEAGANATIANNKGYTPTQVAECHGYYDLLEIL----PRPAST 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42534NP_651560.2 Ank_2 127..226 CDD:289560 11/43 (26%)
ANK 193..335 CDD:238125 34/148 (23%)
ANK repeat 195..226 CDD:293786 7/30 (23%)
Ank_5 214..269 CDD:290568 12/61 (20%)
ANK repeat 228..259 CDD:293786 10/37 (27%)
ANK repeat 314..345 CDD:293786 8/30 (27%)
Ank_2 319..412 CDD:289560 15/92 (16%)
ANK 345..468 CDD:238125 26/122 (21%)
ANK repeat 347..379 CDD:293786 2/31 (6%)
ANK repeat 381..412 CDD:293786 6/30 (20%)
ANK 409..538 CDD:238125 20/69 (29%)
ANK repeat 414..479 CDD:293786 20/64 (31%)
ANK repeat 419..445 CDD:293786 8/25 (32%)
Ank_2 420..511 CDD:289560 20/58 (34%)
ANK repeat 481..511 CDD:293786
Ank_2 486..>545 CDD:289560
ANK repeat 516..542 CDD:293786
GaszNP_610362.1 Ank_2 44..141 CDD:289560 29/134 (22%)
ANK repeat 73..106 CDD:293786 10/39 (26%)
ANK 74..198 CDD:238125 43/230 (19%)
ANK repeat 110..143 CDD:293786 10/64 (16%)
Ank_2 111..208 CDD:289560 36/196 (18%)
ANK repeat 145..175 CDD:293786 10/64 (16%)
ANK repeat 177..208 CDD:293786 14/63 (22%)
SAM 273..324 CDD:197735
SAM_superfamily 273..321 CDD:188886
PHA03233 <289..>366 CDD:223016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X100
11.000

Return to query results.
Submit another query.