DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42534 and nompC

DIOPT Version :9

Sequence 1:NP_651560.2 Gene:CG42534 / 43298 FlyBaseID:FBgn0260487 Length:1555 Species:Drosophila melanogaster
Sequence 2:NP_523483.2 Gene:nompC / 33768 FlyBaseID:FBgn0016920 Length:1761 Species:Drosophila melanogaster


Alignment Length:632 Identity:157/632 - (24%)
Similarity:225/632 - (35%) Gaps:199/632 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 EGCTSLMYACQ---------RGD--IVQVLAQMREKPELLRQRDRSHRNALHYCAAQDSEGSKDL 175
            :|.|:|.|.||         ..|  ||::|  :....::..|...:...|.||||.   .|:.| 
  Fly   577 DGATALHYTCQITKEEVKIPESDKQIVRML--LENGADVTLQTKTALETAFHYCAV---AGNND- 635

  Fly   176 VAAASIAIAAPELLESA----DEDGFTPLHLAVIQGNLAMVNLLLANKADVNAVDNEGHSVVHWA 236
            |....|:...|..::.|    ...|:|||.:|..:|::.:||.||||.|.|:..|.||.|.:|.|
  Fly   636 VLMEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHMELVNNLLANHARVDVFDTEGRSALHLA 700

  Fly   237 T------VC-------------------------------------------------------- 239
            .      ||                                                        
  Fly   701 AERGYLHVCDALLTNKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVIDILTLRKQTPLH 765

  Fly   240 -----GEVESLRAVLAAGASVAKPDANGGTPLHYAAQMCGASKQDSKQQASSSNSSRLSLEILGI 299
                 |::|..:.:|..||::...|..|..|:|.|||               :|.|    |:..:
  Fly   766 LAAASGQMEVCQLLLELGANIDATDDLGQKPIHVAAQ---------------NNYS----EVAKL 811

  Fly   300 LLSHPQSSVDVQDKDGR------------------------------------QPLLWAASAGSA 328
            .|....|.|:...|||.                                    .||..||..|.|
  Fly   812 FLQQHPSLVNATSKDGNTCAHIAAMQGSVKVIEELMKFDRSGVISARNKLTDATPLQLAAEGGHA 876

  Fly   329 KAVIALVKAGARVESSDKDGLTALHCAGSRGHTECIDTLIGLCGAPTDLIDSN----GCTALHYA 389
            ..|.|||:|||.....:|.|.||:|.|...||.:.:|.|     ..|:.:..|    |.|.||.|
  Fly   877 DVVKALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVL-----KSTNSLRINSKKLGLTPLHVA 936

  Fly   390 VTLGHADATARLLD------LEADPNRQD-------RKGRTPAHCGCSKGQFETLKLLK------ 435
            ...|.||....||.      ....|..|.       ..|.||.|.....|....::||.      
  Fly   937 AYYGQADTVRELLTSVPATVKSETPTGQSLFGDLGTESGMTPLHLAAFSGNENVVRLLLNSAGVQ 1001

  Fly   436 ------ERGANLWLRNAKGDLPLHEAAASGRRELLEWLLAQRPKQVNTTSNDGRSLLHIAAANDY 494
                  |.|.|          |||.|...|...::..||::..:.:.:...:||:.|||||.:.:
  Fly  1002 VDAATIENGYN----------PLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGH 1056

  Fly   495 TDMCKLLLDYGADVNAVYRNSRGLVLTPLDGALQRGHRSTAKFLQANGGQPANKVRLSSRRTGNP 559
            ..|.::||..||::||..||.    .|||..|.:.||....|.|...|..|.::.........  
  Fly  1057 IQMVEILLGQGAEINATDRNG----WTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAAIW-- 1115

  Fly   560 FHETNATDMVRPLKYVEKEELHD---LRSSKKYVVYLKRSDSDNGNE 603
            |..:...:.|  |:|:..:| ||   |...|::|..|.....::.|:
  Fly  1116 FAASEGHNEV--LRYLMNKE-HDTYGLMEDKRFVYNLMVVSKNHNNK 1159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42534NP_651560.2 Ank_2 127..226 CDD:289560 34/113 (30%)
ANK 193..335 CDD:238125 51/244 (21%)
ANK repeat 195..226 CDD:293786 14/30 (47%)
Ank_5 214..269 CDD:290568 23/121 (19%)
ANK repeat 228..259 CDD:293786 12/97 (12%)
ANK repeat 314..345 CDD:293786 15/66 (23%)
Ank_2 319..412 CDD:289560 35/102 (34%)
ANK 345..468 CDD:238125 39/151 (26%)
ANK repeat 347..379 CDD:293786 10/31 (32%)
ANK repeat 381..412 CDD:293786 12/40 (30%)
ANK 409..538 CDD:238125 41/147 (28%)
ANK repeat 414..479 CDD:293786 17/76 (22%)
ANK repeat 419..445 CDD:293786 7/37 (19%)
Ank_2 420..511 CDD:289560 27/102 (26%)
ANK repeat 481..511 CDD:293786 13/29 (45%)
Ank_2 486..>545 CDD:289560 23/58 (40%)
ANK repeat 516..542 CDD:293786 8/25 (32%)
nompCNP_523483.2 ANK repeat 129..157 CDD:293786
Ank_2 131..228 CDD:289560
ANK 155..319 CDD:238125
ANK repeat 159..186 CDD:293786
ANK repeat 232..265 CDD:293786
Ank_2 237..331 CDD:289560
ANK 263..387 CDD:238125
ANK repeat 267..298 CDD:293786
ANK repeat 300..331 CDD:293786
Ank_2 305..398 CDD:289560
ANK 329..454 CDD:238125
ANK repeat 367..398 CDD:293786
ANK repeat 400..431 CDD:293786
Ank_2 405..498 CDD:289560
ANK 428..555 CDD:238125
ANK repeat 433..463 CDD:293786
ANK repeat 469..499 CDD:293786
ANK 496..641 CDD:238125 19/69 (28%)
ANK repeat 501..532 CDD:293786
Ank_2 507..616 CDD:289560 10/40 (25%)
ANK repeat 534..575 CDD:293786
ANK repeat 577..616 CDD:293786 10/40 (25%)
Ank_2 625..722 CDD:289560 32/100 (32%)
ANK 654..780 CDD:238125 24/125 (19%)
ANK repeat 660..690 CDD:293786 14/29 (48%)
ANK repeat 692..723 CDD:293786 7/30 (23%)
Ank_2 697..790 CDD:289560 9/92 (10%)
ANK 720..847 CDD:238125 21/145 (14%)
ANK repeat 725..757 CDD:293786 0/31 (0%)
ANK repeat 759..790 CDD:293786 5/30 (17%)
Ank_5 779..834 CDD:290568 19/73 (26%)
ANK 787..915 CDD:238125 38/146 (26%)
ANK repeat 792..824 CDD:293786 12/50 (24%)
ANK repeat 861..893 CDD:293786 13/31 (42%)
Ank_4 865..915 CDD:290365 22/49 (45%)
Ank_4 929..995 CDD:290365 18/65 (28%)
ANK repeat 932..972 CDD:293786 10/39 (26%)
ANK 969..1096 CDD:238125 40/140 (29%)
ANK repeat 974..1007 CDD:293786 7/32 (22%)
Ank_2 979..1074 CDD:289560 28/104 (27%)
ANK repeat 1009..1041 CDD:293786 9/41 (22%)
ANK 1039..1159 CDD:238125 37/128 (29%)
ANK repeat 1043..1074 CDD:293786 14/30 (47%)
Ank_2 1048..1135 CDD:289560 29/95 (31%)
ANK repeat 1076..1101 CDD:293786 9/28 (32%)
ANK repeat 1109..1134 CDD:293786 5/29 (17%)
Ion_trans <1393..1598 CDD:278921
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X100
11.000

Return to query results.
Submit another query.