DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42534 and CG3104

DIOPT Version :9

Sequence 1:NP_651560.2 Gene:CG42534 / 43298 FlyBaseID:FBgn0260487 Length:1555 Species:Drosophila melanogaster
Sequence 2:NP_001259969.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster


Alignment Length:412 Identity:105/412 - (25%)
Similarity:150/412 - (36%) Gaps:105/412 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 LHYCAAQDSEGSKDLVAAASIAIAAPELLESADEDGFTPLHLAVIQGNLAMVNLLLANKADVNAV 225
            ||..|.:..|     ||...:..:....::..||||.|||.||...|:...|..||...||.|:.
  Fly    13 LHMAAMRGDE-----VALLRVLDSGKVHVDCKDEDGTTPLILAAAGGHTYCVMELLDQGADPNSR 72

  Fly   226 DNEGHSVVHWATVCGEVESLRAVLAAGASVAKPDANGGTPLHYAAQMCGASKQDSKQQASSSNSS 290
            ...|.:.:.:|...|.::.::.::.|||||..|.|:|||||..|.|                   
  Fly    73 RLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQ------------------- 118

  Fly   291 RLSLEILGILLSHPQSSVDVQDKDGRQPLLWAASAGSAKAVIALVKAGARVESSDKDGLTALHCA 355
                                              .|..|.|..|:..||.|.:..||..|.:..:
  Fly   119 ----------------------------------GGHVKIVRELLDCGANVNAHMKDRATPVFIS 149

  Fly   356 GSRGHTECIDTLIGLCGAPTDLIDSNGCTALHYAVTLGHADATARLLDLEADPNRQDRKGRTPAH 420
            ...||...:..|| ..||                               |.|..|.|  |.||..
  Fly   150 AQNGHRTVLSLLI-QAGA-------------------------------EIDIKRID--GATPLW 180

  Fly   421 CGCSKGQFETLKLLKERGANLWLRNAKGDLPLHEAAASGRRELLEWLLAQRPKQVNTTSNDGRSL 485
            .....||....|:|.:.|||:......|..||.:||..|...::..||..|| .:....| |.|.
  Fly   181 IAAQMGQDHICKVLLQNGANVDTVRCDGATPLFKAAHKGHAAVITVLLKYRP-NLGQLPN-GESA 243

  Fly   486 LHIAAANDYTDMCKLLLDYGADVNAVYRNSRGLVLTPLDGALQRGHRSTAKFLQANGGQPANKVR 550
            ||.||...:..:||.|:..|:||  :.:|..|  ||.|..|.|:.:.|...:||       .::|
  Fly   244 LHAAAMFGHMTVCKQLVAAGSDV--LLKNHDG--LTALQLAHQQKYTSICDYLQ-------ERIR 297

  Fly   551 LSSRRTGNPFHETNATDMVRPL 572
            ....|:......:..:..|:.:
  Fly   298 TMVARSAKAMATSGVSSTVKTM 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42534NP_651560.2 Ank_2 127..226 CDD:289560 22/64 (34%)
ANK 193..335 CDD:238125 36/141 (26%)
ANK repeat 195..226 CDD:293786 14/30 (47%)
Ank_5 214..269 CDD:290568 20/54 (37%)
ANK repeat 228..259 CDD:293786 8/30 (27%)
ANK repeat 314..345 CDD:293786 7/30 (23%)
Ank_2 319..412 CDD:289560 19/92 (21%)
ANK 345..468 CDD:238125 29/122 (24%)
ANK repeat 347..379 CDD:293786 8/31 (26%)
ANK repeat 381..412 CDD:293786 3/30 (10%)
ANK 409..538 CDD:238125 43/128 (34%)
ANK repeat 414..479 CDD:293786 20/64 (31%)
ANK repeat 419..445 CDD:293786 7/25 (28%)
Ank_2 420..511 CDD:289560 30/90 (33%)
ANK repeat 481..511 CDD:293786 12/29 (41%)
Ank_2 486..>545 CDD:289560 20/58 (34%)
ANK repeat 516..542 CDD:293786 9/25 (36%)
CG3104NP_001259969.1 Ank_2 <13..72 CDD:289560 22/63 (35%)
ANK repeat 13..40 CDD:293786 6/31 (19%)
ANK 37..162 CDD:238125 45/177 (25%)
ANK repeat 42..73 CDD:293786 14/30 (47%)
Ank_2 47..137 CDD:289560 34/142 (24%)
ANK repeat 75..106 CDD:293786 8/30 (27%)
ANK 103..228 CDD:238125 45/211 (21%)
ANK repeat 108..137 CDD:293786 14/81 (17%)
Ank_2 113..202 CDD:289560 33/175 (19%)
ANK repeat 141..171 CDD:293786 10/61 (16%)
ANK 169..292 CDD:238125 44/130 (34%)
ANK repeat 174..204 CDD:293786 11/31 (35%)
Ank_2 179..270 CDD:289560 30/94 (32%)
ANK repeat 207..237 CDD:293786 10/30 (33%)
ANK repeat 239..270 CDD:293786 13/33 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.