DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42534 and Ankrd16

DIOPT Version :9

Sequence 1:NP_651560.2 Gene:CG42534 / 43298 FlyBaseID:FBgn0260487 Length:1555 Species:Drosophila melanogaster
Sequence 2:NP_001028870.1 Gene:Ankrd16 / 307102 RGDID:1311405 Length:370 Species:Rattus norvegicus


Alignment Length:366 Identity:96/366 - (26%)
Similarity:141/366 - (38%) Gaps:51/366 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PETDPDPAQLTVSQSQSSSTVARRRLAEGC---------------TSLMYACQRG--DIVQVLAQ 142
            |..||......|.:.|..:......:|.||               |.|.:|.:.|  ||:..|.:
  Rat     3 PPGDPRRLCRLVQEGQLRALREELEVAGGCWDPEMFRGSQGPAGDTLLHFASRHGRQDILAYLVE 67

  Fly   143 MREKPELLRQRDRSHRNALHYCAAQDSEGSKDLVAAASIAIAAPELLESADEDGFTPLHLAVIQG 207
            .....  :...:|.::..||..|   |.|.:|.|.......|..:.|:.||   :|||.:|..:.
  Rat    68 AWSMD--IEAANRDYKRPLHEAA---SMGHRDCVRYLLGRGAVVDSLKKAD---WTPLMMACTRK 124

  Fly   208 NLAMVNLLLANKADVNAVDNEGHSVVHWATVCGEVESLRAVLAAGASVAKPDAN-GGTPLHYAAQ 271
            ||.::..|:.:.|:....:.:|.:..|.|:..|:...||.:|.....|.|.::. ..||||.|| 
  Rat   125 NLEVIQDLVEHGANPLLKNKDGWNSFHIASREGDPVILRYLLTVCPDVWKTESKIRRTPLHTAA- 188

  Fly   272 MCGASKQDSKQQASSSNSSRLSLEILGILLSHPQSSVDVQDKDGRQPLLWAASAGSAK-AVIALV 335
            |.|.                  .|.:..||.......|.:|..|..|.:.|...|... |.:.|.
  Rat   189 MHGC------------------FEAVQELLERCHYEPDCRDNCGVTPFMDAIQCGHVSIAKLLLE 235

  Fly   336 KAGARVESSDKDGLTALHCAGSRGHTECIDTLIGLCGAPTDL---IDSNGCTALHYAVTLGHADA 397
            ...|...::|..|..|||.|...|..|.|..|:  ||...|:   ..|:..|||.||...|....
  Rat   236 NHEACSSATDSLGAQALHRAAVTGQDEAIRFLV--CGLGIDVDVRAKSSQLTALLYAAKEGQTST 298

  Fly   398 TARLLDLEADPNRQDRKGRTPAHCGCSKGQFETLKLLKERG 438
            ...||.|.||.|..|.:.|:..|..|:.......:.|::.|
  Rat   299 VQTLLSLGADINSTDERNRSALHLACAGQHAACARFLRQSG 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42534NP_651560.2 Ank_2 127..226 CDD:289560 26/100 (26%)
ANK 193..335 CDD:238125 36/143 (25%)
ANK repeat 195..226 CDD:293786 8/30 (27%)
Ank_5 214..269 CDD:290568 15/55 (27%)
ANK repeat 228..259 CDD:293786 9/30 (30%)
ANK repeat 314..345 CDD:293786 7/31 (23%)
Ank_2 319..412 CDD:289560 31/96 (32%)
ANK 345..468 CDD:238125 32/97 (33%)
ANK repeat 347..379 CDD:293786 12/34 (35%)
ANK repeat 381..412 CDD:293786 12/30 (40%)
ANK 409..538 CDD:238125 7/30 (23%)
ANK repeat 414..479 CDD:293786 5/25 (20%)
ANK repeat 419..445 CDD:293786 4/20 (20%)
Ank_2 420..511 CDD:289560 4/19 (21%)
ANK repeat 481..511 CDD:293786
Ank_2 486..>545 CDD:289560
ANK repeat 516..542 CDD:293786
Ankrd16NP_001028870.1 ANK 1 45..75 7/31 (23%)
ANK 46..166 CDD:238125 33/127 (26%)
ANK repeat 46..77 CDD:293786 7/32 (22%)
Ank_2 50..143 CDD:289560 26/100 (26%)
ANK repeat 79..110 CDD:293786 8/33 (24%)
ANK 2 79..108 8/31 (26%)
ANK repeat 112..143 CDD:293786 10/33 (30%)
ANK 3 112..141 10/31 (32%)
ANK 4 145..174 8/28 (29%)
ANK 5 179..209 11/48 (23%)
ANK 181..335 CDD:238125 50/174 (29%)
ANK repeat 181..211 CDD:293786 12/48 (25%)
Ank_2 184..278 CDD:289560 31/114 (27%)
ANK repeat 213..245 CDD:293786 7/31 (23%)
ANK 6 213..242 7/28 (25%)
ANK repeat 247..278 CDD:293786 12/32 (38%)
ANK 7 247..277 12/31 (39%)
Ank_2 252..339 CDD:289560 28/88 (32%)
ANK repeat 281..313 CDD:293786 13/31 (42%)
ANK 8 282..311 11/28 (39%)
ANK 9 315..344 5/25 (20%)
ANK repeat 315..339 CDD:293786 4/23 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X100
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.