DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42534 and DAPK1

DIOPT Version :9

Sequence 1:NP_651560.2 Gene:CG42534 / 43298 FlyBaseID:FBgn0260487 Length:1555 Species:Drosophila melanogaster
Sequence 2:NP_001275658.1 Gene:DAPK1 / 1612 HGNCID:2674 Length:1430 Species:Homo sapiens


Alignment Length:285 Identity:93/285 - (32%)
Similarity:140/285 - (49%) Gaps:26/285 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 ILGILLSHPQSSVDVQDKDGRQPLLWAASAGSAKAVIALVKAGARVESSDKDGLTALHCAGSRGH 360
            :||.|.::   .|:..:|.|..|||.||..|:.:.:..|:|.|:|::..||.|..|::.|...||
Human   363 LLGSLSNY---DVNQPNKHGTPPLLIAAGCGNIQILQLLIKRGSRIDVQDKGGSNAVYWAARHGH 424

  Fly   361 TECIDTLIGL----CGAPTDLIDSNGCTALHYAVTLGHADATARLLDLEADPNRQDRKGRTPAHC 421
               :|||..|    |  |.|:.|.:|..|||.|...||||....|....::||.||::..||.||
Human   425 ---VDTLKFLSENKC--PLDVKDKSGEMALHVAARYGHADVAQLLCSFGSNPNIQDKEEETPLHC 484

  Fly   422 GCSKGQFETLKLLKERGANLWLRNAKGDLPLHEAAASGRRELLEWLLAQRPKQVNTTSNDGRSLL 486
            ....|.:...|.|.|.|.|:.::|.:|:.||..|:|.|..:::| .||:....:|....||...|
Human   485 AAWHGYYSVAKALCEAGCNVNIKNREGETPLLTASARGYHDIVE-CLAEHGADLNACDKDGHIAL 548

  Fly   487 HIAAANDYTDMCKLLLDYGADVNAVYRNSRGLVLTPLDGALQRGHRSTAKFL-QANGGQPANKVR 550
            |:|......::.|.||..|..|:  |::..|  .|||..|.:.|:......| :||     ..:.
Human   549 HLAVRRCQMEVIKTLLSQGCFVD--YQDRHG--NTPLHVACKDGNMPIVVALCEAN-----CNLD 604

  Fly   551 LSSRRTGNPFH---ETNATDMVRPL 572
            :|::....|.|   .....|:||.|
Human   605 ISNKYGRTPLHLAANNGILDVVRYL 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42534NP_651560.2 Ank_2 127..226 CDD:289560
ANK 193..335 CDD:238125 12/38 (32%)
ANK repeat 195..226 CDD:293786
Ank_5 214..269 CDD:290568
ANK repeat 228..259 CDD:293786
ANK repeat 314..345 CDD:293786 11/30 (37%)
Ank_2 319..412 CDD:289560 36/96 (38%)
ANK 345..468 CDD:238125 47/126 (37%)
ANK repeat 347..379 CDD:293786 12/35 (34%)
ANK repeat 381..412 CDD:293786 12/30 (40%)
ANK 409..538 CDD:238125 41/128 (32%)
ANK repeat 414..479 CDD:293786 21/64 (33%)
ANK repeat 419..445 CDD:293786 8/25 (32%)
Ank_2 420..511 CDD:289560 29/90 (32%)
ANK repeat 481..511 CDD:293786 10/29 (34%)
Ank_2 486..>545 CDD:289560 18/59 (31%)
ANK repeat 516..542 CDD:293786 8/26 (31%)
DAPK1NP_001275658.1 STKc_DAPK1 7..275 CDD:271096
Calmodulin-binding 267..334
Autoinhibitory domain. /evidence=ECO:0000250 292..301
ANK 373..497 CDD:238125 47/128 (37%)
ANK repeat 378..409 CDD:293786 11/30 (37%)
ANK 1 378..407 11/28 (39%)
ANK 2 411..440 11/33 (33%)
ANK repeat 412..442 CDD:293786 12/34 (35%)
ANK 439..564 CDD:238125 43/125 (34%)
ANK repeat 444..475 CDD:293786 12/30 (40%)
ANK 3 444..473 11/28 (39%)
ANK repeat 477..508 CDD:293786 10/30 (33%)
ANK 4 477..506 10/28 (36%)
ANK 505..629 CDD:238125 37/133 (28%)
ANK repeat 510..541 CDD:293786 10/31 (32%)
ANK 5 510..539 9/29 (31%)
Ank_2 <515..768 CDD:330894 35/125 (28%)
ANK repeat 543..574 CDD:293786 11/32 (34%)
ANK 6 543..572 10/30 (33%)
ANK repeat 576..607 CDD:293786 9/37 (24%)
ANK 7 576..605 9/35 (26%)
ANK repeat 609..638 CDD:293786 6/21 (29%)
ANK 8 609..638 6/21 (29%)
ANK 9 875..904
ANK 10 1162..1196
Death_DAPK1 1308..1393 CDD:260052
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.