DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42534 and AgaP_AGAP004499

DIOPT Version :9

Sequence 1:NP_651560.2 Gene:CG42534 / 43298 FlyBaseID:FBgn0260487 Length:1555 Species:Drosophila melanogaster
Sequence 2:XP_003436828.1 Gene:AgaP_AGAP004499 / 1274645 VectorBaseID:AGAP004499 Length:669 Species:Anopheles gambiae


Alignment Length:452 Identity:91/452 - (20%)
Similarity:145/452 - (32%) Gaps:154/452 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RRLAEGCTSLMYACQRGDIVQVLAQMREKPELLRQRDRSHRNALHYCAAQDSEGSKDLVAAASIA 182
            :|.::||:.|..||:||::...        |.|          :..|.| ||| .|.|.      
Mosquito    71 KRTSDGCSPLFIACRRGNVYIT--------EYL----------ITVCEA-DSE-QKGLY------ 109

  Fly   183 IAAPELLESADEDGFTPLHLAVIQGNLAMVNLLLANKADVNAVDNEGHSVVHWATVCGEVESLRA 247
                |:.|.......|||..|.:.|.|.:|..|:...:::||:.:.|.:.:..|.....::.::.
Mosquito   110 ----EVPEDRSVHCVTPLWCACVSGKLPVVKCLVRLGSNINALSDTGSTPLRSACFMTHIDIVQF 170

  Fly   248 VLAAGASVAKPDANGGTPLHYAAQMCGASKQDSKQQASSSNSSRLSLEILGILLSHPQSSVDVQD 312
            ::..||.:.||:.||||.|..:.|                     |:.:...|:|.         
Mosquito   171 LVEHGADIRKPNYNGGTCLINSVQ---------------------SVTLCTYLISK--------- 205

  Fly   313 KDGRQPLLWAASAGSAKAVIALVKAGARVESSDKDGLTALHCAGSRGHTECIDTLIGLCGAPTDL 377
                                                                       ||..:.
Mosquito   206 -----------------------------------------------------------GADVNA 211

  Fly   378 IDSNGCTALHYAVTLGHADATARLLDLEADPNRQDRKGRTPAHCGCSKGQFETLKLLKERGANLW 442
            .|....||||||:.....:....||:..|||..:...|.......|.||.:.....||:| .|. 
Mosquito   212 RDIQNKTALHYAIQEHRLETAQLLLEHGADPFAKSHYGDDALQTACLKGAYHIFDYLKKR-INY- 274

  Fly   443 LRNAKGDLPLHEAAAS--------GRRELLEWLLAQ----RPKQVNTTSNDGRSLLHIAAANDYT 495
              :|:.....||...|        .|..:|.|.:|.    |..:..|.............|:::|
Mosquito   275 --SAERLADAHELFGSTLIDDLNVTRGAVLHWRMAHQIRLREAEYITKKPPVEPRAAYGFASEFT 337

  Fly   496 DMCKLLLDYGADVNA-------VYRNSRGLVLTPLDGALQRGHRSTAKFLQANGGQPANKVR 550
            .:.: |.:..||::|       :|....|:           .||.|...|...|...|:..|
Mosquito   338 TIPE-LDNIAADMDAMRVQSLLIYERILGI-----------DHRDTLFRLMFRGASYADAHR 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42534NP_651560.2 Ank_2 127..226 CDD:289560 26/98 (27%)
ANK 193..335 CDD:238125 25/141 (18%)
ANK repeat 195..226 CDD:293786 10/30 (33%)
Ank_5 214..269 CDD:290568 14/54 (26%)
ANK repeat 228..259 CDD:293786 5/30 (17%)
ANK repeat 314..345 CDD:293786 0/30 (0%)
Ank_2 319..412 CDD:289560 14/92 (15%)
ANK 345..468 CDD:238125 29/130 (22%)
ANK repeat 347..379 CDD:293786 2/31 (6%)
ANK repeat 381..412 CDD:293786 11/30 (37%)
ANK 409..538 CDD:238125 29/147 (20%)
ANK repeat 414..479 CDD:293786 18/76 (24%)
ANK repeat 419..445 CDD:293786 7/25 (28%)
Ank_2 420..511 CDD:289560 23/109 (21%)
ANK repeat 481..511 CDD:293786 6/36 (17%)
Ank_2 486..>545 CDD:289560 13/65 (20%)
ANK repeat 516..542 CDD:293786 5/25 (20%)
AgaP_AGAP004499XP_003436828.1 Ank_2 <67..147 CDD:289560 27/105 (26%)
ANK repeat 75..149 CDD:293786 28/103 (27%)
ANK 121..236 CDD:238125 34/203 (17%)
Ank_2 123..245 CDD:289560 37/210 (18%)
ANK repeat 152..182 CDD:293786 5/29 (17%)
ANK repeat 184..213 CDD:293786 11/117 (9%)
ANK repeat 215..245 CDD:293786 11/29 (38%)
ANK <558..635 CDD:238125
ANK repeat 578..611 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X100
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.