DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42534 and AgaP_AGAP013068

DIOPT Version :9

Sequence 1:	NP_651560.2	Gene:	CG42534 / 43298	FlyBaseID:	FBgn0260487	Length:	1555	Species:	Drosophila melanogaster
Sequence 2:	XP_003435896.1	Gene:	AgaP_AGAP013068 / 11175781	VectorBaseID:	AGAP013068	Length:	139	Species:	Anopheles gambiae

Alignment Length:	178	Identity:	42/178 - (23%)
Similarity:	63/178 - (35%)	Gaps:	74/178 - (41%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MQKRPKAEVKRVRGPAKPPRLKAAKKQLQFESPLPRRTRTMQQQQQQDNDHPPQQEKQEQQQQQQ 65
            |:.|.:...:|...|.|..:...||..::|
Mosquito     1 MEPRSEPRTRRAGSPVKVKKKSTAKHTVKF----------------------------------- 30

  Fly    66 QRQEAADKVIAM--------PGSSQDTDAAAE-------AAVDV----------PETD------- 98
             :.:|.|.|:.:        |||.:.:...|.       |:|..          |.||
Mosquito    31 -KDQARDDVLVVTVEPPSPSPGSPEPSPKTAVTFALPPIASVSYQRPKTGGEKPPTTDTRALPKE 94

  Fly    99 PDPAQLTVSQSQSSSTVARRRLAEGCTSLMYACQRGDIVQVLAQMREK 146
            .||.:.|...:.|      :||||||||||||||:|....:|.::|:|
Mosquito    95 KDPTKRTAKPADS------QRLAEGCTSLMYACQQGLTGDILKELRQK 136

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42534	NP_651560.2	Ank_2	127..226	CDD:289560	10/20 (50%)
		ANK	193..335	CDD:238125
		ANK repeat	195..226	CDD:293786
		Ank_5	214..269	CDD:290568
		ANK repeat	228..259	CDD:293786
		ANK repeat	314..345	CDD:293786
		Ank_2	319..412	CDD:289560
		ANK	345..468	CDD:238125
		ANK repeat	347..379	CDD:293786
		ANK repeat	381..412	CDD:293786
		ANK	409..538	CDD:238125
		ANK repeat	414..479	CDD:293786
		ANK repeat	419..445	CDD:293786
		Ank_2	420..511	CDD:289560
		ANK repeat	481..511	CDD:293786
		Ank_2	486..>545	CDD:289560
		ANK repeat	516..542	CDD:293786
AgaP_AGAP013068	XP_003435896.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	1	1.000	45	1.000	Domainoid score	I19354
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0012729
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	2.000