| Sequence 1: | NP_651560.2 | Gene: | CG42534 / 43298 | FlyBaseID: | FBgn0260487 | Length: | 1555 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_003435897.1 | Gene: | AgaP_AGAP013191 / 11175612 | VectorBaseID: | AGAP013191 | Length: | 327 | Species: | Anopheles gambiae |
| Alignment Length: | 268 | Identity: | 168/268 - (62%) |
|---|---|---|---|
| Similarity: | 193/268 - (72%) | Gaps: | 43/268 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1311 MERKIFQHLLELKSLQIRSSKLNEAVLVKRAVDDYHKSCVLLGGETGTRLRRYNFSEYTFKNFEL 1375
Fly 1376 FLYETLKGLQRPGTNNFQNINEVYEEAERRLSPDYNAYEKALQCTTKTHRCLHAAHAYTGIPCAA 1440
Fly 1441 YIPMMNHHTMPKFGFGPYK-KTGSVSSFFLPKILTSGRASSGRAGGIGSASGSRCNHKVALELSH 1504
Fly 1505 GKNKQLISLPAEKLDSNKRYYVTFTVK-----------DSSG-------------------PSAY 1539
Fly 1540 QQQQHQQQ 1547 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42534 | NP_651560.2 | Ank_2 | 127..226 | CDD:289560 | |
| ANK | 193..335 | CDD:238125 | |||
| ANK repeat | 195..226 | CDD:293786 | |||
| Ank_5 | 214..269 | CDD:290568 | |||
| ANK repeat | 228..259 | CDD:293786 | |||
| ANK repeat | 314..345 | CDD:293786 | |||
| Ank_2 | 319..412 | CDD:289560 | |||
| ANK | 345..468 | CDD:238125 | |||
| ANK repeat | 347..379 | CDD:293786 | |||
| ANK repeat | 381..412 | CDD:293786 | |||
| ANK | 409..538 | CDD:238125 | |||
| ANK repeat | 414..479 | CDD:293786 | |||
| ANK repeat | 419..445 | CDD:293786 | |||
| Ank_2 | 420..511 | CDD:289560 | |||
| ANK repeat | 481..511 | CDD:293786 | |||
| Ank_2 | 486..>545 | CDD:289560 | |||
| ANK repeat | 516..542 | CDD:293786 | |||
| AgaP_AGAP013191 | XP_003435897.1 | None | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0012729 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||