DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42534 and ccdc71l

DIOPT Version :9

Sequence 1:	NP_651560.2	Gene:	CG42534 / 43298	FlyBaseID:	FBgn0260487	Length:	1555	Species:	Drosophila melanogaster
Sequence 2:	NP_001241871.1	Gene:	ccdc71l / 100380119	XenbaseID:	XB-GENE-5838650	Length:	214	Species:	Xenopus tropicalis

Alignment Length:	125	Identity:	30/125 - (24%)
Similarity:	44/125 - (35%)	Gaps:	23/125 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   552 SSRRTGNPFHETNATDMVRPLKYVEKEELHDLRSSKKYVVYLKRSDSDNGNENGKADVGDGDCSC 616
            |||   |...:..|..:..|.|...|.:...:|.:.|......|:||..|:|    :.|.|...|
Frog    81 SSR---NVKEKPQAAVVPPPRKPPVKRKRRGMRLTCKKRRRRDRADSAGGSE----ETGSGSSGC 138

  Fly   617 SEQTYRKEQRLRHVCRRHKR------------RQLRRRTSSCGESKHERCSEICRSKSNI 664
            |..|......|.|:.|..:.            ..:|.|..||    ..:.::.||....|
Frog   139 SSPTPSDVPGLPHLDRSIEEIWKAATPKIAMFPSIRVRDVSC----KAKVADACRRAQEI 194

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42534	NP_651560.2	Ank_2	127..226	CDD:289560
		ANK	193..335	CDD:238125
		ANK repeat	195..226	CDD:293786
		Ank_5	214..269	CDD:290568
		ANK repeat	228..259	CDD:293786
		ANK repeat	314..345	CDD:293786
		Ank_2	319..412	CDD:289560
		ANK	345..468	CDD:238125
		ANK repeat	347..379	CDD:293786
		ANK repeat	381..412	CDD:293786
		ANK	409..538	CDD:238125
		ANK repeat	414..479	CDD:293786
		ANK repeat	419..445	CDD:293786
		Ank_2	420..511	CDD:289560
		ANK repeat	481..511	CDD:293786
		Ank_2	486..>545	CDD:289560
		ANK repeat	516..542	CDD:293786
ccdc71l	NP_001241871.1	CCDC71L	2..>84	CDD:373797	3/5 (60%)
ccdc71l	NP_001241871.1	CCDC71L	<164..206	CDD:373797	7/35 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X100
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000