DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42534 and ccdc71l

DIOPT Version :9

Sequence 1:NP_651560.2 Gene:CG42534 / 43298 FlyBaseID:FBgn0260487 Length:1555 Species:Drosophila melanogaster
Sequence 2:NP_001241871.1 Gene:ccdc71l / 100380119 XenbaseID:XB-GENE-5838650 Length:214 Species:Xenopus tropicalis


Alignment Length:125 Identity:30/125 - (24%)
Similarity:44/125 - (35%) Gaps:23/125 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   552 SSRRTGNPFHETNATDMVRPLKYVEKEELHDLRSSKKYVVYLKRSDSDNGNENGKADVGDGDCSC 616
            |||   |...:..|..:..|.|...|.:...:|.:.|......|:||..|:|    :.|.|...|
 Frog    81 SSR---NVKEKPQAAVVPPPRKPPVKRKRRGMRLTCKKRRRRDRADSAGGSE----ETGSGSSGC 138

  Fly   617 SEQTYRKEQRLRHVCRRHKR------------RQLRRRTSSCGESKHERCSEICRSKSNI 664
            |..|......|.|:.|..:.            ..:|.|..||    ..:.::.||....|
 Frog   139 SSPTPSDVPGLPHLDRSIEEIWKAATPKIAMFPSIRVRDVSC----KAKVADACRRAQEI 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42534NP_651560.2 Ank_2 127..226 CDD:289560
ANK 193..335 CDD:238125
ANK repeat 195..226 CDD:293786
Ank_5 214..269 CDD:290568
ANK repeat 228..259 CDD:293786
ANK repeat 314..345 CDD:293786
Ank_2 319..412 CDD:289560
ANK 345..468 CDD:238125
ANK repeat 347..379 CDD:293786
ANK repeat 381..412 CDD:293786
ANK 409..538 CDD:238125
ANK repeat 414..479 CDD:293786
ANK repeat 419..445 CDD:293786
Ank_2 420..511 CDD:289560
ANK repeat 481..511 CDD:293786
Ank_2 486..>545 CDD:289560
ANK repeat 516..542 CDD:293786
ccdc71lNP_001241871.1 CCDC71L 2..>84 CDD:373797 3/5 (60%)
CCDC71L <164..206 CDD:373797 7/35 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X100
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.