DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42534 and cdkn2d

DIOPT Version :9

Sequence 1:	NP_651560.2	Gene:	CG42534 / 43298	FlyBaseID:	FBgn0260487	Length:	1555	Species:	Drosophila melanogaster
Sequence 2:	XP_002662282.2	Gene:	cdkn2d / 100333252	ZFINID:	ZDB-GENE-110316-1	Length:	154	Species:	Danio rerio

Alignment Length:	124	Identity:	44/124 - (35%)
Similarity:	66/124 - (53%)	Gaps:	4/124 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   347 DGL---TALHCAGSRGHTECIDTLIGLCGAPTDLIDSNGCTALHYAVTLGHADATARLLDLEADP 408
            |||   .:|..|.::|....:..::.......|.::..|.|||. .:.:|.:...|.|||..|||
Zfish     5 DGLGCGKSLSAAAAQGDARAVRRILQDHRVEPDALNEFGKTALQ-VMMMGSSAVAAVLLDFGADP 68

  Fly   409 NRQDRKGRTPAHCGCSKGQFETLKLLKERGANLWLRNAKGDLPLHEAAASGRRELLEWL 467
            |.|||.|.||||.....|..|||::|.:.||::.:.:..|.||||.|...|..:::|:|
Zfish    69 NVQDRSGVTPAHDAARTGFLETLRVLVDGGASVNVPDHSGALPLHIAVREGHWDVVEYL 127

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42534	NP_651560.2	Ank_2	127..226	CDD:289560
		ANK	193..335	CDD:238125
		ANK repeat	195..226	CDD:293786
		Ank_5	214..269	CDD:290568
		ANK repeat	228..259	CDD:293786
		ANK repeat	314..345	CDD:293786
		Ank_2	319..412	CDD:289560	20/67 (30%)
		ANK	345..468	CDD:238125	44/124 (35%)
		ANK repeat	347..379	CDD:293786	7/34 (21%)
		ANK repeat	381..412	CDD:293786	13/30 (43%)
		ANK	409..538	CDD:238125	25/59 (42%)
		ANK repeat	414..479	CDD:293786	21/54 (39%)
		ANK repeat	419..445	CDD:293786	9/25 (36%)
		Ank_2	420..511	CDD:289560	17/48 (35%)
		ANK repeat	481..511	CDD:293786
		Ank_2	486..>545	CDD:289560
		ANK repeat	516..542	CDD:293786
cdkn2d	XP_002662282.2	ANK	27..127	CDD:238125	37/100 (37%)
		Ank_2	27..105	CDD:289560	29/78 (37%)
		ANK repeat	42..72	CDD:293786	13/30 (43%)
		ANK repeat	74..105	CDD:293786	12/30 (40%)
		Ank_4	75..127	CDD:290365	20/51 (39%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910