DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmu and PNPT1

DIOPT Version :9

Sequence 1:NP_477159.1 Gene:Hmu / 43294 FlyBaseID:FBgn0015737 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_149100.2 Gene:PNPT1 / 87178 HGNCID:23166 Length:783 Species:Homo sapiens


Alignment Length:309 Identity:63/309 - (20%)
Similarity:104/309 - (33%) Gaps:98/309 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 WTDSSSDFTIEDLVFASFANPSGRLFKYNRSKNVSEVLLDELAFANGLALSPNEDFIVVAETGAM 249
            |:.:.|.....||........||:|.:                ||:|.|:..:.|..|:..  |:
Human    39 WSSAGSRAVAVDLGNRKLEISSGKLAR----------------FADGSAVVQSGDTAVMVT--AV 85

  Fly   250 RLTK------------YHLKGAKAGQSEVFVDGLPGLPDNLTPDAEGIWVPLVQSADSEHPNGFT 302
            ..||            |..|.|.||:          :|.|......|       ::|.|      
Human    86 SKTKPSPSQFMPLVVDYRQKAAAAGR----------IPTNYLRREIG-------TSDKE------ 127

  Fly   303 LFTRFPSVRLFLARMLALFELPFRYLNSVYPNKFSQRFVHFVGHMESITVLAPKRTTVV----RV 363
            :.|.    |:....:..||...:.|...|..|..:      |..:....|||....:|.    .:
Human   128 ILTS----RIIDRSIRPLFPAGYFYDTQVLCNLLA------VDGVNEPDVLAINGASVALSLSDI 182

  Fly   364 DWNGNI----VGSLHG--------FDKSAATVSHVLEFQDFLFLGSPTNQYLARVKSPK------ 410
            .|||.:    :|.:.|        .:.|::|::.|:       .|:|.:|.:....|.:      
Human   183 PWNGPVGAVRIGIIDGEYVVNPTRKEMSSSTLNLVV-------AGAPKSQIVMLEASAENILQQD 240

  Fly   411 ---AKQPTLKVRNVRVEG-EGLEASIGVPPSKATPKPKAAPSTTTPKPT 455
               |.:..:|.....::| :.|....||  :|.||:....||....|.|
Human   241 FCHAIKVGVKYTQQIIQGIQQLVKETGV--TKRTPQKLFTPSPEIVKYT 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmuNP_477159.1 YvrE 61..>287 CDD:225921 24/113 (21%)
Str_synth 173..258 CDD:304606 17/84 (20%)
PNPT1NP_149100.2 PRK11824 49..752 CDD:236995 61/299 (20%)
RNase_PH_PNPase_1 49..273 CDD:206768 55/283 (19%)
PNPase 282..363 CDD:281688 2/6 (33%)
RNase_PH_PNPase_2 366..596 CDD:206769
KH-I 605..664 CDD:294072
S1 679..750 CDD:197648
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1185
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.