DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmu and SS2

DIOPT Version :9

Sequence 1:NP_477159.1 Gene:Hmu / 43294 FlyBaseID:FBgn0015737 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_177542.1 Gene:SS2 / 843740 AraportID:AT1G74020 Length:335 Species:Arabidopsis thaliana


Alignment Length:366 Identity:94/366 - (25%)
Similarity:156/366 - (42%) Gaps:90/366 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GPECLI--ARNNEIYTGIHGGEVIK-LTSNHVTHVTKIGQPCEDIYEE--------SRCGRPLGL 122
            |||...  :.....|||:.||:::| |.........:|.:.....:.:        .|||||.|:
plant    38 GPEAFAFDSTGKGFYTGVSGGKILKYLPETGYVDFAQITESSNSSWCDGTIGTALAGRCGRPAGI 102

  Fly   123 AFDTQGNNLIIADAYYGLWQVDLGTNKKTLLVSPAQELAGK---SIN-RPAKIFNGVTVS-KEGD 182
            ||:.:..:|.:|||..||.           ::|||..||.|   |:: :|.|..:|:.|. ..|.
plant   103 AFNEKTGDLYVADAPLGLH-----------VISPAGGLATKITDSVDGKPFKFLDGLDVDPTTGV 156

  Fly   183 VYWTDSSSDFT-IEDLVFASFANPSGRLFKYNRSKNVSEVLLDELAFANGLALSPNEDFIVVAET 246
            ||:|..||.|: |:.|:.....:.:|:|:||:.|..|..||::.|:.:.|.|:|.:..|::|::.
plant   157 VYFTSFSSRFSPIQVLIALGLKDATGKLYKYDPSTKVVTVLMEGLSGSAGCAVSSDGSFVLVSQF 221

  Fly   247 GAMRLTKYHLKGAKAGQSEVFVDGLPGLPDNL--TPDAEGIWVPLVQSADSEHPNGFTLFTRFPS 309
            ....:.:|.:||.|||.||.|.:.:.. |||:  .......||..|                   
plant   222 TKSNIKRYWIKGPKAGSSEDFTNSVSN-PDNIKRIGSTGNFWVASV------------------- 266

  Fly   310 VRLFLARMLALFELPFRYLNSVYPNKFSQRFVHFVGHMESITVLAPKRTTVVRVDWNGNIVGSLH 374
                                   .||                ::.|...:.|:|:.||.::.::.
plant   267 -----------------------VNK----------------IIVPTNPSAVKVNSNGEVLQTIP 292

  Fly   375 GFDKSAAT-VSHVLEFQDFLFLGSPTNQYLARVKSPKAKQP 414
            ..||...| :|.|.||:..|::|:.|..:...:|..|...|
plant   293 LKDKFGDTLLSEVNEFEGNLYIGTLTGPFAGILKLEKGSCP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmuNP_477159.1 YvrE 61..>287 CDD:225921 71/236 (30%)
Str_synth 173..258 CDD:304606 26/86 (30%)
SS2NP_177542.1 YvrE 44..293 CDD:225921 78/318 (25%)
Str_synth 146..234 CDD:281131 27/87 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 48 1.000 Domainoid score I4480
eggNOG 1 0.900 - - E1_COG1185
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D757814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3471
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10426
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X608
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.