DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmu and AT1G74010

DIOPT Version :9

Sequence 1:NP_477159.1 Gene:Hmu / 43294 FlyBaseID:FBgn0015737 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_177541.1 Gene:AT1G74010 / 843739 AraportID:AT1G74010 Length:325 Species:Arabidopsis thaliana


Alignment Length:363 Identity:92/363 - (25%)
Similarity:144/363 - (39%) Gaps:99/363 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GPECL-IARNNEIYTGIHGGEVIKL--------------TSNHVTHVTKIGQPCEDIYEESRCGR 118
            |||.. .......|||:.||:::|.              :||.......:|...     ..:|||
plant    37 GPESFAFDSTGGFYTGVSGGKILKYVPGKGYVDFAQITDSSNSAWCNGALGTAF-----AGKCGR 96

  Fly   119 PLGLAFDTQGNNLIIADAYYGLWQVDLGTNKKTLLVSPAQELAGK---SIN-RPAKIFNGVTVS- 178
            |.|:|.:::..:|.:|||..||.           ::|||..||.|   |:: :|.|..:|:.|. 
plant    97 PAGIALNSKTGDLYVADAPLGLH-----------VISPAGGLATKLADSVDGKPFKFLDGLDVDP 150

  Fly   179 KEGDVYWTDSSSDF-TIEDLVFASFANPSGRLFKYNRSKNVSEVLLDELAFANGLALSPNEDFIV 242
            ..|.||:|..||.| ..|.|:.....:.||:||||:.:......|::.|:.|.|.|:|.:..|::
plant   151 TTGVVYFTSFSSKFGPREVLIAVGLKDASGKLFKYDPATKAVTELMEGLSGAAGCAVSSDGSFVL 215

  Fly   243 VAETGAMRLTKYHLKGAKAGQSEVFVDGLPGLPDNL--TPDAEGIWVPLVQSADSEHPNGFTLFT 305
            |:|.....:.||.:||.|||..|.| ..|...|||:  .......||..|               
plant   216 VSEFIKSNIKKYWIKGPKAGTIEDF-SSLVSNPDNIRRVGSTGNFWVASV--------------- 264

  Fly   306 RFPSVRLFLARMLALFELPFRYLNSVYPNKFSQRFVHFVGHMESITVLAPKRTTVVRVDWNGNIV 370
                                       .||                |:.|.....|::|.||.::
plant   265 ---------------------------VNK----------------VVMPTDPRAVKLDANGKVL 286

  Fly   371 GSLHGFDKSAAT-VSHVLEFQDFLFLGSPTNQYLARVK 407
            .::...::...| :|.|.||...|::|:.|..:...:|
plant   287 QTIFLKNEFGNTLLSEVNEFNGHLYIGTLTGPFAGVMK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmuNP_477159.1 YvrE 61..>287 CDD:225921 72/240 (30%)
Str_synth 173..258 CDD:304606 28/86 (33%)
AT1G74010NP_177541.1 YvrE 38..289 CDD:225921 82/325 (25%)
Str_synth 144..232 CDD:281131 29/87 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 48 1.000 Domainoid score I4480
eggNOG 1 0.900 - - E1_COG1185
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D757814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3471
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10426
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X608
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.