DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmu and SS3

DIOPT Version :9

Sequence 1:NP_477159.1 Gene:Hmu / 43294 FlyBaseID:FBgn0015737 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_177540.3 Gene:SS3 / 843738 AraportID:AT1G74000 Length:329 Species:Arabidopsis thaliana


Alignment Length:352 Identity:90/352 - (25%)
Similarity:145/352 - (41%) Gaps:88/352 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GRVYGPECLI--ARNNEIYTGIHGGEVIKLTSN-------HVTHVTKIGQPCEDIY---EESRCG 117
            |...|||...  :.....|||:.||:::|....       .:|:.:| ...|:...   ...:||
plant    36 GNRTGPEAFAFDSTGKGFYTGVTGGKILKYLPKKGYVDFAQITNSSK-SSLCDGALGTTNVEKCG 99

  Fly   118 RPLGLAFDTQGNNLIIADAYYGLWQVDL--GTNKKTLLVSPAQELAGKSINRPAKIFNGVTVS-K 179
            ||.|:||:|:..:|.:|||..||..:..  |..||.     |..:.||    |....:|:.|. .
plant   100 RPAGIAFNTKTGDLYVADAALGLHVIPRRGGLAKKI-----ADSVGGK----PFLFLDGLDVDPT 155

  Fly   180 EGDVYWTDSSSDFTIEDLVFA-SFANPSGRLFKYNRSKNVSEVLLDELAFANGLALSPNEDFIVV 243
            .|.||:|..||.|...|::.| :..:.:|:.|||:.||.|..||::.|:.:.|.|:|.:..|::|
plant   156 TGVVYFTSFSSTFGPRDVLKAVATKDSTGKFFKYDPSKKVVTVLMEGLSGSAGCAVSSDGSFVLV 220

  Fly   244 AETGAMRLTKYHLKGAKAGQSEVFVDGLPGLPDNL--TPDAEGIWVPLVQSADSEHPNGFTLFTR 306
            .:.....:.:|.:||:|||.||.|.:.:.. |||:  .......||..|                
plant   221 GQFTKSNIKRYWIKGSKAGTSEDFTNSVSN-PDNIKRIGSTGNFWVASV---------------- 268

  Fly   307 FPSVRLFLARMLALFELPFRYLNSVYPNKFSQRFVHFVGHMESITVLAPKRTTVVRVDWNGNIVG 371
                                 :||                     ...|...:.|:|...|.::.
plant   269 ---------------------VNS---------------------ATGPTNPSAVKVSSAGKVLQ 291

  Fly   372 SLHGFDKSAAT-VSHVLEFQDFLFLGS 397
            ::...||...| ||.|.|::..|::|:
plant   292 TIPLKDKFGDTLVSEVNEYKGQLYIGA 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmuNP_477159.1 YvrE 61..>287 CDD:225921 72/239 (30%)
Str_synth 173..258 CDD:304606 27/86 (31%)
SS3NP_177540.3 YvrE 46..295 CDD:225921 77/317 (24%)
Str_synth 148..236 CDD:354965 28/87 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 48 1.000 Domainoid score I4480
eggNOG 1 0.900 - - E1_COG1185
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I1870
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D757814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3471
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10426
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X608
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.