DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmu and AT3G57020

DIOPT Version :9

Sequence 1:NP_477159.1 Gene:Hmu / 43294 FlyBaseID:FBgn0015737 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_191261.1 Gene:AT3G57020 / 824869 AraportID:AT3G57020 Length:370 Species:Arabidopsis thaliana


Alignment Length:258 Identity:75/258 - (29%)
Similarity:119/258 - (46%) Gaps:38/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 HLEGAERLLEGR------VYGPECL--IARNNEIYTGIHGGEVIK------------LTSNHVTH 99
            :||||:.:|...      |.|||.:  ..:....|..:..|.::|            .||.|..:
plant    33 NLEGAKNVLTMAKTIPIPVAGPESIEFDPKGEGPYAAVVDGRILKWRGDDLGWVDFAYTSPHRGN 97

  Fly   100 VTKIGQPCEDIYEESRCGRPLGLAFDTQGNNLIIADAYYGLWQVDLGTNKKTLLVSPAQELAGKS 164
                   |........|||||||.|:.:..:|.|.|.|.||.:|........|:|..|:      
plant    98 -------CSKTEVVPTCGRPLGLTFEKKTGDLYICDGYLGLMKVGPEGGLAELIVDEAE------ 149

  Fly   165 INRPAKIFNGVTVSKEGDV-YWTDSSSDFTIEDLVFASFANP-SGRLFKYNRSKNVSEVLLDELA 227
             .|.....|...:.:|.|| |:.|||..:...|:.|.:.:.. |||:.:|::....::|::|.|.
plant   150 -GRKVMFANQGDIDEEEDVFYFNDSSDKYHFRDVFFVAVSGERSGRVIRYDKKTKEAKVIMDNLV 213

  Fly   228 FANGLALSPNEDFIVVAETGAMRLTKYHLKGAKAGQSEVFVDGLPGLPDNLTPDAEG-IWVPL 289
            ..|||||:.:..|::..|:|...:.:|.:||.|||..::|.. :||.|||:...:.| .|:.|
plant   214 CNNGLALNKDRSFLITCESGTSLVHRYWIKGPKAGTRDIFAK-VPGYPDNIRLTSTGDFWIGL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmuNP_477159.1 YvrE 61..>287 CDD:225921 69/248 (28%)
Str_synth 173..258 CDD:304606 26/86 (30%)
AT3G57020NP_191261.1 YvrE 54..>276 CDD:225921 68/237 (29%)
Str_synth 157..245 CDD:354965 27/87 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3710
eggNOG 1 0.900 - - E1_COG1185
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41380
Inparanoid 1 1.050 131 1.000 Inparanoid score I1870
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D757814at2759
OrthoFinder 1 1.000 - - FOG0001350
OrthoInspector 1 1.000 - - otm3471
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10426
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X608
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.