DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bigmax and RTG3

DIOPT Version :9

Sequence 1:NP_651556.2 Gene:bigmax / 43293 FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_009447.1 Gene:RTG3 / 852171 SGDID:S000000199 Length:486 Species:Saccharomyces cerevisiae


Alignment Length:229 Identity:54/229 - (23%)
Similarity:87/229 - (37%) Gaps:53/229 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GSTHTP----NSSAHNSDDDDDSGDARHSAAANSTLSYKERRREAHTQAEQKRRDAIKKGYDSLQ 95
            ||.:||    .|.:.|..::...|.........::.....|:||.|...|::||:.||:....|.
Yeast   245 GSINTPRTRHTSISSNMTENIGPGSVPKILGGLTSDEKLRRKREFHNAVERRRRELIKQKIKELG 309

  Fly    96 ELVPRCQPN-DSSG--YKLSKALILQKSIEYIGYLNQ-------------QKLKQEDEGSALQKE 144
            :|||....| |..|  .|.:|.:||.:::||:.||.:             .|:|:.:|   .:..
Yeast   310 QLVPPSLLNYDDLGKQIKPNKGIILDRTVEYLQYLAEILEIQARKKKALLAKIKELEE---KKSS 371

  Fly   145 VTALRIIKNGYENMLQHQQANPGPEEARLTDEAKFQVFQAIMEEM-------------------- 189
            |.||....|.:.  ....|.|....|.|:.|..  .|..|:|.|.                    
Yeast   372 VAALSPFTNNHH--ASSGQNNSENSEERIIDIR--SVPNALMNEQNSKAELHNWEPPLYDSVGNH 432

  Fly   190 -----FETFQHIPM-ENFKQLTTGIIPWLEEHCK 217
                 .|:..|..: |..|:..:|.:...|::.|
Yeast   433 NHAGTMESHPHTNIHEELKEFLSGDLIEAEDNAK 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 24/76 (32%)
RTG3NP_009447.1 bHLHzip_USF_MITF 289..349 CDD:381393 21/59 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.