DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bigmax and AT1G10120

DIOPT Version :10

Sequence 1:NP_651556.2 Gene:bigmax / 43293 FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_172483.4 Gene:AT1G10120 / 837549 AraportID:AT1G10120 Length:366 Species:Arabidopsis thaliana


Alignment Length:100 Identity:32/100 - (32%)
Similarity:49/100 - (49%) Gaps:16/100 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NSSAHNSDDDDDSGDARHSAAANSTLSYKE-------RRREA---HTQAEQKRRDAIKKGYDSLQ 95
            |..:.....:|.|.:..:..::.|..:.||       ||.:|   |:.||:.||:.|.:....||
plant   172 NDQSQKKHKNDQSKETVNKESSQSEEAPKENYIHMRARRGQATNSHSLAERVRREKISERMRLLQ 236

  Fly    96 ELVPRCQPNDSSGYKLSKALILQKSIEYIGYLNQQ 130
            ||||.|  |..:|    ||::|.:.|.|:..|.||
plant   237 ELVPGC--NKITG----KAVMLDEIINYVQSLQQQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 bHLHzip_Mlx 71..145 CDD:381530 25/62 (40%)
AT1G10120NP_172483.4 bHLH_AtBPE_like 202..287 CDD:381489 25/69 (36%)

Return to query results.
Submit another query.