DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bigmax and PIF3

DIOPT Version :10

Sequence 1:NP_651556.2 Gene:bigmax / 43293 FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_172424.1 Gene:PIF3 / 837479 AraportID:AT1G09530 Length:524 Species:Arabidopsis thaliana


Alignment Length:149 Identity:47/149 - (31%)
Similarity:69/149 - (46%) Gaps:32/149 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DNNNALATKEDVFGMEHDQDHTSKHYSRCSSAGS-------THTPNSS------------AHNSD 48
            ||..|....||  ....||:  |:....|||.||       :.:|:.|            .|:.|
plant   258 DNQKACLISED--SCRKDQE--SEKAVVCSSVGSGNSLDGPSESPSLSLKRKHSNIQDIDCHSED 318

  Fly    49 DDDDSGDARHSAAANST--LSYKERRREAHTQAEQKRRDAIKKGYDSLQELVPRCQPNDSSGYKL 111
            .:::|||.|..|..:.|  .|.:.|..|.|..:|::|||.|.:...:||||:|.|.       |:
plant   319 VEEESGDGRKEAGPSRTGLGSKRSRSAEVHNLSERRRRDRINEKMRALQELIPNCN-------KV 376

  Fly   112 SKALILQKSIEYIGYLNQQ 130
            .||.:|.::|||:..|..|
plant   377 DKASMLDEAIEYLKSLQLQ 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 bHLHzip_Mlx 71..145 CDD:381530 23/60 (38%)
PIF3NP_172424.1 bHLH_AtPIF_like 343..405 CDD:381451 23/60 (38%)

Return to query results.
Submit another query.