DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bigmax and MYC4

DIOPT Version :9

Sequence 1:NP_651556.2 Gene:bigmax / 43293 FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_193522.1 Gene:MYC4 / 827511 AraportID:AT4G17880 Length:589 Species:Arabidopsis thaliana


Alignment Length:325 Identity:60/325 - (18%)
Similarity:105/325 - (32%) Gaps:140/325 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GMEHDQDHTSKHYSRCSSAGSTHTPN-------------SSAHNSDDDDDSG------------- 54
            |.:...:..|:..|:..:..|...||             :...|..::|.|.             
plant   299 GNDSTSNSDSQPISKLCNGSSVENPNPKVLKSCEMVNFKNGIENGQEEDSSNKKRSPVSNNEEGM 363

  Fly    55 ---------DARHS---------AAANSTLSYKERR-----------REA---HTQAEQKRRDAI 87
                     |:.||         |.:|..:...|::           ||.   |.:||::||:.:
plant   364 LSFTSVLPCDSNHSDLEASVAKEAESNRVVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKL 428

  Fly    88 KKGYDSLQELVPRCQPNDSSGYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQKEVTAL---- 148
            .:.:.||:.:||...       |:.||.:|..:|.||..|..:..|.|.:...|||::..:    
plant   429 NQRFYSLRAVVPNVS-------KMDKASLLGDAISYISELKSKLQKAESDKEELQKQIDVMNKEA 486

  Fly   149 ---------------------------RIIKNGYENMLQHQ---QANPGPEEARLTDEAKFQVFQ 183
                                       :||  |::.|::.|   :.:||         |||    
plant   487 GNAKSSVKDRKCLNQESSVLIEMEVDVKII--GWDAMIRIQCSKRNHPG---------AKF---- 536

  Fly   184 AIMEEMFETFQHIPMENFKQLTTGIIPWLEEHCKPHILRNILSRTLQQMAQEAMEKQELQAMEQE 248
                          ||..|:|...:     .|....::.::       |.|:|..|...|...|:
plant   537 --------------MEALKELDLEV-----NHASLSVVNDL-------MIQQATVKMGNQFFTQD 575

  Fly   249  248
            plant   576  575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 20/74 (27%)
MYC4NP_193522.1 bHLH-MYC_N 63..250 CDD:290915
HLH 415..466 CDD:238036 17/57 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 42 1.000 Domainoid score I4771
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.