DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bigmax and PIL6

DIOPT Version :9

Sequence 1:NP_651556.2 Gene:bigmax / 43293 FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001030889.1 Gene:PIL6 / 825075 AraportID:AT3G59060 Length:444 Species:Arabidopsis thaliana


Alignment Length:263 Identity:63/263 - (23%)
Similarity:103/263 - (39%) Gaps:56/263 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NNALATKEDVFG------------MEHDQDHTSKHYSRCSSAGSTHTPNSSAHNSDDDDDSGDAR 57
            ||    ||.|.|            |:.||:..|:     |..|.|.|.:.:..|. ....||..|
plant   199 NN----KETVSGTSVTIDRKRKHVMDADQESVSQ-----SDIGLTSTDDQTMGNK-SSQRSGSTR 253

  Fly    58 HSAAANSTLSYKERRREAHTQAEQKRRDAIKKGYDSLQELVPRCQPNDSSGYKLSKALILQKSIE 122
            .|.||           |.|..:|::|||.|.:...:||||:|.|...|       ||.||.::|:
plant   254 RSRAA-----------EVHNLSERRRRDRINERMKALQELIPHCSRTD-------KASILDEAID 300

  Fly   123 YIGYLNQQKLKQEDEGSALQKEVTALRIIKNGYENMLQHQQANPGPEEARLTDEAKFQVFQAIME 187
            |:..| |.:|:....||.:.....|.     ....|....|::|...:..:..:.:...|..:..
plant   301 YLKSL-QMQLQVMWMGSGMAAAAAAA-----ASPMMFPGVQSSPYINQMAMQSQMQLSQFPVMNR 359

  Fly   188 EMFETFQHIPMENFKQLTTGIIPWLEEHCKPHILRNILSRTLQQMAQEAMEKQELQAMEQESSE- 251
            ...:....:..:|..|        |:...:..||...|:|.:..:.|......::|.::|:.:: 
plant   360 SAPQNHPGLVCQNPVQ--------LQLQAQNQILSEQLARYMGGIPQMPPAGNQMQTVQQQPADM 416

  Fly   252 -GF 253
             ||
plant   417 LGF 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 21/60 (35%)
PIL6NP_001030889.1 bHLH_AtPIF_like 256..318 CDD:381451 27/80 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 42 1.000 Domainoid score I4771
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I2566
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
33.010

Return to query results.
Submit another query.