DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bigmax and PIL1

DIOPT Version :9

Sequence 1:NP_651556.2 Gene:bigmax / 43293 FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_182220.2 Gene:PIL1 / 819311 AraportID:AT2G46970 Length:416 Species:Arabidopsis thaliana


Alignment Length:248 Identity:65/248 - (26%)
Similarity:105/248 - (42%) Gaps:31/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TSKHYSRCS---SAGSTHTPNSS--AHNSDDDDDSGDARHSAAANSTLSYKERRREAHTQAEQKR 83
            ||:..|.||   ..|......|:  ::||||:.|....:..|.....::.::|..|.|...|:||
plant   177 TSRDLSCCSLKRKYGDIEEEESTYLSNNSDDESDDAKTQVHARTRKPVTKRKRSTEVHKLYERKR 241

  Fly    84 RDAIKKGYDSLQELVPRCQPNDSSGYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQKEVTAL 148
            ||...|...:||:|:|.|       ||..||.:|.::|:|:..| |.:::....|:.|.:..|.|
plant   242 RDEFNKKMRALQDLLPNC-------YKDDKASLLDEAIKYMRTL-QLQVQMMSMGNGLIRPPTML 298

  Fly   149 RIIKNGYENMLQHQQANPGPEEARLTDEAKFQVFQAIMEEMFETFQHIP--MENFKQLTTGIIP- 210
            .:.......:..|..|...|     |...:|.... :....|....:.|  |.:|....:|:|| 
plant   299 PMGHYSPMGLGMHMGAAATP-----TSIPQFLPMN-VQATGFPGMNNAPPQMLSFLNHPSGLIPN 357

  Fly   211 -----WLEEHCKPHILRNILSRT----LQQMAQEAMEKQELQAMEQESSEGFS 254
                 .||...:|.::.:.:|:|    ..|..:.|.......||:...|.|||
plant   358 TPIFSPLENCSQPFVVPSCVSQTQATSFTQFPKSASASNLEDAMQYRGSNGFS 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 22/60 (37%)
PIL1NP_182220.2 bHLH_AtPIF_like 229..292 CDD:381451 24/70 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 42 1.000 Domainoid score I4771
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I2566
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.920

Return to query results.
Submit another query.