DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bigmax and MLX

DIOPT Version :9

Sequence 1:NP_651556.2 Gene:bigmax / 43293 FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_733752.1 Gene:MLX / 6945 HGNCID:11645 Length:298 Species:Homo sapiens


Alignment Length:210 Identity:102/210 - (48%)
Similarity:142/210 - (67%) Gaps:10/210 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SRCSSAGSTHTPNSSAHNSDDDDDSGDARHSAAANSTLSYKERRREAHTQAEQKRRDAIKKGYDS 93
            ||.:|.|||..  ||..|:||:|..   .|..|...  |||:|||.||||||||||||||:|||.
Human    94 SRANSIGSTSA--SSVPNTDDEDSD---YHQEAYKE--SYKDRRRRAHTQAEQKRRDAIKRGYDD 151

  Fly    94 LQELVPRCQPNDSS--GYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQKEVTALRIIKNGYE 156
            ||.:||.||..|.|  ..|||||::|||:|:||.:|:::|.|||:|.|.|:|:||||:|:|..||
Human   152 LQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYE 216

  Fly   157 NMLQHQQANPGPEEARLTDEAKFQVFQAIMEEMFETFQ-HIPMENFKQLTTGIIPWLEEHCKPHI 220
            .:::..|.||...|.:::|:.||.|||.||:.:|::|. .|.:.:|::|:..:..|:||||||..
Human   217 QIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQT 281

  Fly   221 LRNILSRTLQQMAQE 235
            ||.|:...|.|:..:
Human   282 LREIVIGVLHQLKNQ 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 41/62 (66%)
MLXNP_733752.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..145 31/57 (54%)
HLH 130..188 CDD:306515 38/57 (67%)
Leucine-zipper 140..160 14/19 (74%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141622
Domainoid 1 1.000 96 1.000 Domainoid score I7377
eggNOG 1 0.900 - - E1_KOG1319
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7969
Inparanoid 1 1.050 189 1.000 Inparanoid score I3909
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45474
OrthoDB 1 1.010 - - D1234389at2759
OrthoFinder 1 1.000 - - FOG0007499
OrthoInspector 1 1.000 - - oto89061
orthoMCL 1 0.900 - - OOG6_106895
Panther 1 1.100 - - LDO PTHR15741
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5340
SonicParanoid 1 1.000 - - X6384
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.