DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bigmax and mlx

DIOPT Version :9

Sequence 1:NP_651556.2 Gene:bigmax / 43293 FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_017209811.1 Gene:mlx / 554119 ZFINID:ZDB-GENE-050522-316 Length:253 Species:Danio rerio


Alignment Length:257 Identity:103/257 - (40%)
Similarity:153/257 - (59%) Gaps:34/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDNNNALATKEDVF-----------GMEH----DQDHTSKHYSRCSSAGSTHTPNSSAHNSDDD 50
            |::|:   |:.||.:           |.:|    :........||.:|.|||..  ||..|:||:
Zfish     1 MTENS---ASPEDPWLKQTDGTFSDNGFDHSFFAESARKGSLVSRANSIGSTSA--SSVPNTDDE 60

  Fly    51 DDSGDARHSAAANSTLSYKERRREAHTQAEQKRR------DAIKKGYDSLQELVPRCQPNDS--- 106
            |  .|.||......  |||:|||.||||||||||      ||.:||||.||.:||.||....   
Zfish    61 D--SDNRHETPYKE--SYKDRRRHAHTQAEQKRRDNQGMCDAFQKGYDDLQSIVPTCQQQSDFSM 121

  Fly   107 SGYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQKEVTALRIIKNGYENMLQHQQANPGPEEA 171
            :..|:|||.:|||:|:||.:|:::|.|||::.|.|:|||.||:|:|..||::::..|.||.....
Zfish   122 ATQKMSKATVLQKTIDYIQFLHKEKKKQEEDVSTLRKEVMALKIMKTNYEHIVKAHQNNPQQGSE 186

  Fly   172 RLTDEAKFQVFQAIMEEMFETFQ-HIPMENFKQLTTGIIPWLEEHCKPHILRNILSRTLQQM 232
            :::|:.||.|||:||:.:|::|. .:.:.:|::|:..:..|:||||||..||..:...|||:
Zfish   187 QVSDQVKFSVFQSIMDSLFQSFSASVSVSSFQELSACVFSWIEEHCKPQTLREFVVTVLQQV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 37/69 (54%)
mlxXP_017209811.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574616
Domainoid 1 1.000 94 1.000 Domainoid score I7482
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7969
Inparanoid 1 1.050 141 1.000 Inparanoid score I4461
OMA 1 1.010 - - QHG45474
OrthoDB 1 1.010 - - D1234389at2759
OrthoFinder 1 1.000 - - FOG0007499
OrthoInspector 1 1.000 - - oto41425
orthoMCL 1 0.900 - - OOG6_106895
Panther 1 1.100 - - LDO PTHR15741
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6384
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.