DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bigmax and AT4G28815

DIOPT Version :10

Sequence 1:NP_651556.2 Gene:bigmax / 43293 FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001078463.1 Gene:AT4G28815 / 5008171 AraportID:AT4G28815 Length:307 Species:Arabidopsis thaliana


Alignment Length:70 Identity:25/70 - (35%)
Similarity:37/70 - (52%) Gaps:7/70 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 AANSTLSYKERRREAHTQAEQKRRDAIKKGYDSLQELVPRCQPNDSSGYKLSKALILQKSIEYIG 125
            |..||...:.|..|.|..||::||:.|.:...:||:|:|||.       |.:|..:|:..|||:.
plant   140 ARGSTSRKRSRAAEMHNLAERRRREKINERMKTLQQLIPRCN-------KSTKVSMLEDVIEYVK 197

  Fly   126 YLNQQ 130
            .|..|
plant   198 SLEMQ 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 bHLHzip_Mlx 71..145 CDD:381530 22/60 (37%)
AT4G28815NP_001078463.1 bHLH_AtPIF_like 150..213 CDD:381451 22/60 (37%)
PABP-1234 <201..299 CDD:130689 1/2 (50%)

Return to query results.
Submit another query.