DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bigmax and sre2

DIOPT Version :9

Sequence 1:NP_651556.2 Gene:bigmax / 43293 FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_595229.1 Gene:sre2 / 2541044 PomBaseID:SPBC354.05c Length:793 Species:Schizosaccharomyces pombe


Alignment Length:193 Identity:45/193 - (23%)
Similarity:78/193 - (40%) Gaps:47/193 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALATKEDVFGMEHDQDHTSKHYSRCSSAGSTHTPNSSAH------NSDDDDDSGDARHSAAANST 65
            ::::|.....:..|..:.|   |:.:..|.:.:|:||:.      |..:...|..|..:..:|..
pombe   349 SISSKRSYGDIAQDCSYIS---SKTNGGGPSDSPSSSSTSVRGSVNDSNSPISSSATFAIQSNGV 410

  Fly    66 ----LSYKER------RREAHTQAEQKRRDAIKKGYDSLQELVPRCQPNDSSGY----------- 109
                ||.:|:      :|.||...|::.|..:......|::.||..:    |||           
pombe   411 EPVGLSTQEQNLSPLSKRSAHNMIEKRYRSNLNDKIAELRDAVPTLR----SGYNSTTADELKGT 471

  Fly   110 ------KLSKALILQKSIEYIGYLNQQKLKQEDEGSALQKEVTALRIIKNGYENMLQHQQANP 166
                  ||:||.||.|:.|||..|..:..|..:|...|||.::.       |.:::|.....|
pombe   472 YVPLSRKLNKATILSKATEYIKSLQSKNKKLIEENKILQKRLSE-------YTSVIQASLTAP 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 23/83 (28%)
sre2NP_595229.1 HLH 427..496 CDD:278439 21/72 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.