DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bigmax and sre1

DIOPT Version :9

Sequence 1:NP_651556.2 Gene:bigmax / 43293 FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_595694.1 Gene:sre1 / 2540730 PomBaseID:SPBC19C2.09 Length:900 Species:Schizosaccharomyces pombe


Alignment Length:227 Identity:46/227 - (20%)
Similarity:80/227 - (35%) Gaps:72/227 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDNNNALATKEDVFGMEHDQDHTSKHYSRCSSAGSTHTPNSSAHN---SDDDDDS--------- 53
            ||:....|.|:|.:..|:                 :|..|..||..   |...:||         
pombe   188 MSNPEVKLKTEEIITPMD-----------------TTCKPEPSAKKIKLSPSSEDSCSIPETLPF 235

  Fly    54 --GDARHSAAANSTLSY-----KERRREAHTQAEQKRRDAIKKGYDSLQELVP--------RC-- 101
              ..:|.|.:.:.|..:     .:.::.||...|::.|..:......|::.||        ||  
pombe   236 SAPKSRGSLSPSETPDFVAGPGGKPKKTAHNMIEKRYRTNLNDRICELRDAVPSLRAAAALRCGN 300

  Fly   102 --QPNDSSGY----KLSKALILQKSIEYIGYLN------QQKLKQEDEGSALQKE---------- 144
              ...|..|.    ||:|..||.|:.|||.:|.      |:..||..:..|..::          
pombe   301 SLDDEDLGGLTPARKLNKGTILAKATEYIRHLEAKNKELQKTNKQLSDRLAFYEDPSMAPPSNDT 365

  Fly   145 --VTALRIIKNGYENMLQHQQANPGPEEARLT 174
              |.::.::.:...::  ||.:.|...:...|
pombe   366 RAVNSVNVVSSSDYSV--HQSSRPNLTQRAFT 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 21/82 (26%)
sre1NP_595694.1 HLH 261..333 CDD:278439 20/71 (28%)
DUF2014 517..766 CDD:286510
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.