DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bigmax and Mlx

DIOPT Version :9

Sequence 1:NP_651556.2 Gene:bigmax / 43293 FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_035680.3 Gene:Mlx / 21428 MGIID:108398 Length:298 Species:Mus musculus


Alignment Length:223 Identity:102/223 - (45%)
Similarity:147/223 - (65%) Gaps:10/223 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GMEHDQDHTSKHYSRCSSAGSTHTPNSSAHNSDDDDDSGDARHSAAANSTLSYKERRREAHTQAE 80
            |:..:..|.....||.:|.|||..  ||..|:||:|  .|.:..:...   |||:|||.||||||
Mouse    81 GLFVESTHKGSVVSRANSIGSTSA--SSVPNTDDED--SDYQQESYKE---SYKDRRRRAHTQAE 138

  Fly    81 QKRRDAIKKGYDSLQELVPRCQPNDSS--GYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQK 143
            ||||||||:|||.||.:||.||..|.|  ..|||||::|||:|:||.:|:::|.|||:|.|.|:|
Mouse   139 QKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRK 203

  Fly   144 EVTALRIIKNGYENMLQHQQANPGPEEARLTDEAKFQVFQAIMEEMFETFQ-HIPMENFKQLTTG 207
            :||||:|:|..||.:::..|.||...|.:::|:.||.|||.||:.:|::|. .|.:.:|::|:..
Mouse   204 DVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSAC 268

  Fly   208 IIPWLEEHCKPHILRNILSRTLQQMAQE 235
            :..|:||||:|..||.|:...|.|:..:
Mouse   269 VFSWIEEHCEPQTLREIVIGVLHQLKNQ 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 41/62 (66%)
MlxNP_035680.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..119 11/24 (46%)
HLH 130..188 CDD:278439 38/57 (67%)
Leucine-zipper 194..214 12/19 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831569
Domainoid 1 1.000 94 1.000 Domainoid score I7490
eggNOG 1 0.900 - - E1_KOG1319
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7969
Inparanoid 1 1.050 190 1.000 Inparanoid score I3876
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45474
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007499
OrthoInspector 1 1.000 - - oto92628
orthoMCL 1 0.900 - - OOG6_106895
Panther 1 1.100 - - LDO PTHR15741
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5340
SonicParanoid 1 1.000 - - X6384
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.