DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bigmax and mxl-2

DIOPT Version :9

Sequence 1:NP_651556.2 Gene:bigmax / 43293 FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_497173.1 Gene:mxl-2 / 175184 WormBaseID:WBGene00003510 Length:205 Species:Caenorhabditis elegans


Alignment Length:187 Identity:48/187 - (25%)
Similarity:93/187 - (49%) Gaps:11/187 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SRCSSAGSTHTPNS-SAHNSDDDDDSGDARHSAAANSTLSYKERRREAHTQAEQKRRDAIKKGYD 92
            ||.::|.|:..|:. ...:.|....|..|.::.|.||.....:|::..|.:.|::||:||..||.
 Worm     4 SRSAAASSSQKPDDMDLMSPDGSASSPSAPNTPATNSGGFSSDRKKATHLRCERQRREAINSGYS 68

  Fly    93 SLQELVPRCQPNDSSGYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQKEVTALRIIKNGYEN 157
            .|::|:|  |...|.|.|.:.|.||.::.:::..|.......:.:.:.|..:..||.:|.:.|| 
 Worm    69 DLKDLIP--QTTTSLGCKTTNAAILFRACDFMSQLKTDISDADKQLAQLNAQAAALEMIASEYE- 130

  Fly   158 MLQHQQANPGPEEARLTDEAKFQVFQAIMEEMFETF-QHIPMENFKQLTTGIIPWLE 213
                |.|:..|:..:.|.:.|  :.|.::::.|.:| ..:....:..:|..::.|:|
 Worm   131 ----QMASSVPDAGQSTIQVK--MLQLLLDDCFTSFSSQVDFTTYATITRTLLSWVE 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 20/60 (33%)
mxl-2NP_497173.1 bHLHzip_Mlx_like 47..110 CDD:381410 20/64 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1319
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3897
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45474
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007499
OrthoInspector 1 1.000 - - oto19760
orthoMCL 1 0.900 - - OOG6_106895
Panther 1 1.100 - - LDO PTHR15741
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5340
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.860

Return to query results.
Submit another query.