DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bigmax and mlx

DIOPT Version :9

Sequence 1:NP_651556.2 Gene:bigmax / 43293 FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_004918784.1 Gene:mlx / 101732928 XenbaseID:XB-GENE-970062 Length:226 Species:Xenopus tropicalis


Alignment Length:216 Identity:101/216 - (46%)
Similarity:142/216 - (65%) Gaps:15/216 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SRCSSAGST---HTPNSSAHNSDD------DDDSGDARHSAAANSTLSYKERRREAHTQAEQKRR 84
            ||.:|.|||   ..||::.:..|:      ||:..|.|.....|   .||:|||.||||||||||
 Frog     9 SRANSIGSTSASSVPNTACNMMDNACSLTSDDEDSDDRQETIKN---DYKDRRRRAHTQAEQKRR 70

  Fly    85 DAIKKGYDSLQELVPRCQPNDSS--GYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQKEVTA 147
            ||||||||.||.:||.||..|.:  ..|||||::|||:|:||.:||::|.||||:.|.|:|||.|
 Frog    71 DAIKKGYDDLQCIVPTCQQQDIAIGTQKLSKAVVLQKTIDYIQFLNKEKKKQEDDVSTLRKEVMA 135

  Fly   148 LRIIKNGYENMLQHQQANPGPEEARLTDEAKFQVFQAIMEEMFETF-QHIPMENFKQLTTGIIPW 211
            |:|:|:.||.:::..|.|......::.||.||:|||.||:.:|.|| ..:.:.:|::|:..:..|
 Frog   136 LQIMKSNYEQIVKAHQNNLHEGTDQVPDEMKFRVFQGIMDSLFHTFNSSVSVNSFQELSACVFAW 200

  Fly   212 LEEHCKPHILRNILSRTLQQM 232
            :||||||..|::|:.|.|.|:
 Frog   201 IEEHCKPQTLQDIVIRFLHQL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 42/62 (68%)
mlxXP_004918784.1 bHLHzip_Mlx 57..133 CDD:381530 49/75 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7366
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H7969
Inparanoid 1 1.050 184 1.000 Inparanoid score I3830
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1234389at2759
OrthoFinder 1 1.000 - - FOG0007499
OrthoInspector 1 1.000 - - oto102924
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6384
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.