DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5938 and Chic2

DIOPT Version :9

Sequence 1:NP_001097947.2 Gene:CG5938 / 43290 FlyBaseID:FBgn0046247 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001099206.1 Gene:Chic2 / 83835 RGDID:1309278 Length:165 Species:Rattus norvegicus


Alignment Length:165 Identity:105/165 - (63%)
Similarity:140/165 - (84%) Gaps:1/165 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SDFDAIYEDEQLDELEHFQDQTVAPVQEPIIIRGAGNMTVFGLSNRFNAEFPCGLLSRVAPEEFK 68
            :|||.|||:|: ||....::|.:....:|:::||:|::|||||||:|.:|||..|..:|||||||
  Rat     2 ADFDEIYEEEE-DEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFK 65

  Fly    69 ATVGRINGVLKKSLPVNVKWLFCGCVCCCCTLGCSLWPVICLSKRTQLTLDKLFEWENNHLYHKL 133
            |::.|:|..|:|:|||||:||.|||:|||||||||:||||||||||:.:::||.|||||.|||||
  Rat    66 ASINRVNSCLRKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKL 130

  Fly   134 GLHWRLHKQQCDSNSMMEYVILIEFIPKTPIYRPD 168
            .|||||.|::|::|:||||||||||:|||||:|||
  Rat   131 CLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5938NP_001097947.2 Erf4 49..137 CDD:287258 59/87 (68%)
Chic2NP_001099206.1 Erf4 46..134 CDD:402047 59/87 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334690
Domainoid 1 1.000 153 1.000 Domainoid score I4188
eggNOG 1 0.900 - - E1_KOG4101
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8105
Inparanoid 1 1.050 248 1.000 Inparanoid score I3171
OMA 1 1.010 - - QHG47997
OrthoDB 1 1.010 - - D1449345at2759
OrthoFinder 1 1.000 - - FOG0003641
OrthoInspector 1 1.000 - - otm45244
orthoMCL 1 0.900 - - OOG6_105429
Panther 1 1.100 - - LDO PTHR13005
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2509
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.