DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5938 and chic2

DIOPT Version :9

Sequence 1:NP_001097947.2 Gene:CG5938 / 43290 FlyBaseID:FBgn0046247 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_957414.1 Gene:chic2 / 394095 ZFINID:ZDB-GENE-040426-778 Length:169 Species:Danio rerio


Alignment Length:167 Identity:101/167 - (60%)
Similarity:138/167 - (82%) Gaps:3/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFDAIYEDEQLDELEH---FQDQTVAPVQEPIIIRGAGNMTVFGLSNRFNAEFPCGLLSRVAPEE 66
            |||.|||:|:.:|.:.   .::|.:....:|:::||:|::|||||||:|.:|||..|..:|||||
Zfish     3 DFDEIYEEEEEEEEDEDRAAEEQLLKYAPDPVVVRGSGHVTVFGLSNKFESEFPSALTGKVAPEE 67

  Fly    67 FKATVGRINGVLKKSLPVNVKWLFCGCVCCCCTLGCSLWPVICLSKRTQLTLDKLFEWENNHLYH 131
            ||:::.|:|..|:|:|||||:||.|||:|||||||.||||||||||||:.:::||.||||:.|||
Zfish    68 FKSSINRVNSCLRKALPVNVRWLLCGCLCCCCTLGFSLWPVICLSKRTRRSIEKLLEWENSRLYH 132

  Fly   132 KLGLHWRLHKQQCDSNSMMEYVILIEFIPKTPIYRPD 168
            ||.|||||.|::|::|:||||||||||:||.||:|||
Zfish   133 KLCLHWRLSKRKCETNNMMEYVILIEFLPKIPIFRPD 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5938NP_001097947.2 Erf4 49..137 CDD:287258 57/87 (66%)
chic2NP_957414.1 Erf4 50..138 CDD:287258 57/87 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573897
Domainoid 1 1.000 156 1.000 Domainoid score I4148
eggNOG 1 0.900 - - E1_KOG4101
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8105
Inparanoid 1 1.050 247 1.000 Inparanoid score I3246
OMA 1 1.010 - - QHG47997
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003641
OrthoInspector 1 1.000 - - otm26272
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2509
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.