DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5938 and Chic1

DIOPT Version :9

Sequence 1:NP_001097947.2 Gene:CG5938 / 43290 FlyBaseID:FBgn0046247 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_001056014.2 Gene:Chic1 / 363484 RGDID:1589722 Length:226 Species:Rattus norvegicus


Alignment Length:170 Identity:100/170 - (58%)
Similarity:133/170 - (78%) Gaps:12/170 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EDEQLDELEHFQDQTVAP------------VQEPIIIRGAGNMTVFGLSNRFNAEFPCGLLSRVA 63
            |:::.||.|..:::...|            ..:|:::||||::|||||||:|:.|||..|..:||
  Rat    57 EEDEEDEEEEEEEEVPPPPRVVSEENLRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVA 121

  Fly    64 PEEFKATVGRINGVLKKSLPVNVKWLFCGCVCCCCTLGCSLWPVICLSKRTQLTLDKLFEWENNH 128
            |||||.::||:|..|||:||||||||.|||:||||||||||||||||:|||:.::.||.|||||.
  Rat   122 PEEFKTSIGRVNSCLKKALPVNVKWLLCGCLCCCCTLGCSLWPVICLNKRTRRSIQKLLEWENNR 186

  Fly   129 LYHKLGLHWRLHKQQCDSNSMMEYVILIEFIPKTPIYRPD 168
            |||||.|||:|.|::|::::||||||||||:||.||:|||
  Rat   187 LYHKLALHWKLTKRKCETSNMMEYVILIEFLPKYPIFRPD 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5938NP_001097947.2 Erf4 49..137 CDD:287258 61/87 (70%)
Chic1XP_001056014.2 Erf4 107..>139 CDD:287258 17/31 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334691
Domainoid 1 1.000 153 1.000 Domainoid score I4188
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I3171
OMA 1 1.010 - - QHG47997
OrthoDB 1 1.010 - - D1449345at2759
OrthoFinder 1 1.000 - - FOG0003641
OrthoInspector 1 1.000 - - otm45244
orthoMCL 1 0.900 - - OOG6_105429
Panther 1 1.100 - - O PTHR13005
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2509
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.