DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5938 and chic1

DIOPT Version :9

Sequence 1:NP_001097947.2 Gene:CG5938 / 43290 FlyBaseID:FBgn0046247 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_004916890.1 Gene:chic1 / 101732617 XenbaseID:XB-GENE-6039630 Length:184 Species:Xenopus tropicalis


Alignment Length:180 Identity:105/180 - (58%)
Similarity:142/180 - (78%) Gaps:15/180 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SFSDFDAIYE-DEQLDELEHFQDQTVAP------------VQEPIIIRGAGNMTVFGLSNRFNAE 53
            :.:|||.||| ||  :|.|:.:::..|.            ..:|:::||||::|||||||:|:||
 Frog     7 NMADFDTIYELDE--EEEENGEERAAASGRAVDEAHLLRYAPDPVVVRGAGHITVFGLSNKFDAE 69

  Fly    54 FPCGLLSRVAPEEFKATVGRINGVLKKSLPVNVKWLFCGCVCCCCTLGCSLWPVICLSKRTQLTL 118
            ||..|..:|||||||.::||:|..|:|:||::||||.|||:|||||||||||||:||:|||:.::
 Frog    70 FPSVLTGKVAPEEFKISIGRVNACLRKNLPLSVKWLLCGCICCCCTLGCSLWPVVCLNKRTRRSI 134

  Fly   119 DKLFEWENNHLYHKLGLHWRLHKQQCDSNSMMEYVILIEFIPKTPIYRPD 168
            .||.|||||.|||||||||:|.:::|:||:||||||||||:||.||:|||
 Frog   135 YKLLEWENNRLYHKLGLHWKLSRRKCESNNMMEYVILIEFLPKYPIFRPD 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5938NP_001097947.2 Erf4 49..137 CDD:287258 59/87 (68%)
chic1XP_004916890.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 158 1.000 Domainoid score I4068
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 252 1.000 Inparanoid score I3130
OMA 1 1.010 - - QHG47997
OrthoDB 1 1.010 - - D1449345at2759
OrthoFinder 1 1.000 - - FOG0003641
OrthoInspector 1 1.000 - - otm48307
Panther 1 1.100 - - O PTHR13005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2509
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.