DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5934 and Scoc

DIOPT Version :9

Sequence 1:NP_651552.1 Gene:CG5934 / 43289 FlyBaseID:FBgn0039505 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_001034226.1 Gene:Scoc / 56367 MGIID:1927654 Length:125 Species:Mus musculus


Alignment Length:122 Identity:62/122 - (50%)
Similarity:78/122 - (63%) Gaps:25/122 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 MDSLR------SSFTNRSSTPDSSHN------------------SLEAMEMA-QDDREEKARLIT 77
            ||.|.      |:||:.|...|:.|:                  .::|::.. |.:.|||.|||.
Mouse     4 MDGLSTGEEEDSTFTSISLEDDTDHSLKSWRSRAESLLPKMMNADMDAVDAENQVELEEKTRLIN 68

  Fly    78 QVLELQNTLDDLSQRVDSVKEENLKLRSENQVLGQYIENLMSASSVFQSTSPSAAKK 134
            ||||||:||:|||.|||:||||||||:|||||||||||||||||||||:|...:.:|
Mouse    69 QVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5934NP_651552.1 DUF2205 60..125 CDD:402019 49/65 (75%)
ScocNP_001034226.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 9/26 (35%)
DUF2205 45..116 CDD:287227 49/70 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835719
Domainoid 1 1.000 99 1.000 Domainoid score I7130
eggNOG 1 0.900 - - E1_KOG3650
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I4962
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006236
OrthoInspector 1 1.000 - - oto91876
orthoMCL 1 0.900 - - OOG6_105613
Panther 1 1.100 - - LDO PTHR21614
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3199
SonicParanoid 1 1.000 - - X4518
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.780

Return to query results.
Submit another query.