DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5934 and scoca

DIOPT Version :9

Sequence 1:NP_651552.1 Gene:CG5934 / 43289 FlyBaseID:FBgn0039505 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_001071027.1 Gene:scoca / 562638 ZFINID:ZDB-GENE-061013-114 Length:119 Species:Danio rerio


Alignment Length:115 Identity:61/115 - (53%)
Similarity:72/115 - (62%) Gaps:18/115 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 MDSLRSSFTNRSSTPDS-----------SHNSLEAMEMAQD-------DREEKARLITQVLELQN 84
            :|....:|||.|...||           |......|....|       ::|||.|||.||||||:
Zfish     5 VDEDDGTFTNISLADDSADGEPTVLRFRSEEQYSTMNCEIDGDMENQVEQEEKTRLINQVLELQH 69

  Fly    85 TLDDLSQRVDSVKEENLKLRSENQVLGQYIENLMSASSVFQSTSPSAAKK 134
            ||:|||.|||:||||||||:|||||||||||||||||||||:|...:.:|
Zfish    70 TLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRK 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5934NP_651552.1 DUF2205 60..125 CDD:402019 49/71 (69%)
scocaNP_001071027.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 7/20 (35%)
DUF2205 40..110 CDD:287227 49/69 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579053
Domainoid 1 1.000 101 1.000 Domainoid score I6903
eggNOG 1 0.900 - - E1_KOG3650
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I4948
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1581498at2759
OrthoFinder 1 1.000 - - FOG0006236
OrthoInspector 1 1.000 - - otm24475
orthoMCL 1 0.900 - - OOG6_105613
Panther 1 1.100 - - LDO PTHR21614
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4518
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.760

Return to query results.
Submit another query.