DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5934 and scoc

DIOPT Version :9

Sequence 1:NP_651552.1 Gene:CG5934 / 43289 FlyBaseID:FBgn0039505 Length:135 Species:Drosophila melanogaster
Sequence 2:XP_031751380.1 Gene:scoc / 100494794 XenbaseID:XB-GENE-949187 Length:125 Species:Xenopus tropicalis


Alignment Length:86 Identity:57/86 - (66%)
Similarity:71/86 - (82%) Gaps:2/86 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TPDSSHNS-LEAMEMA-QDDREEKARLITQVLELQNTLDDLSQRVDSVKEENLKLRSENQVLGQY 113
            :|.:..|| ::|:|:. |.:.|||.|||.||||||:||:|||.|||:||||||||:|||||||||
 Frog    40 SPSAVMNSDMDALEVENQVELEEKTRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQY 104

  Fly   114 IENLMSASSVFQSTSPSAAKK 134
            ||||||||||||:|...:.:|
 Frog   105 IENLMSASSVFQTTDTKSKRK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5934NP_651552.1 DUF2205 60..125 CDD:402019 50/65 (77%)
scocXP_031751380.1 DUF2205 45..116 CDD:402019 52/70 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I7011
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1581498at2759
OrthoFinder 1 1.000 - - FOG0006236
OrthoInspector 1 1.000 - - oto102191
Panther 1 1.100 - - LDO PTHR21614
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4518
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.020

Return to query results.
Submit another query.