DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)mbt and scml4

DIOPT Version :9

Sequence 1:NP_733209.1 Gene:l(3)mbt / 43288 FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_001332433.4 Gene:scml4 / 794170 ZFINID:ZDB-GENE-041210-338 Length:475 Species:Danio rerio


Alignment Length:545 Identity:104/545 - (19%)
Similarity:154/545 - (28%) Gaps:234/545 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   964 MHLEAEDLNDTGKICVATVTDILDERIRVHFDGWDD-------CYDLWVHITSPYIHPCGWHEGR 1021
            |.|...||.|:....:.:|..:...|:|:..|..||       ..||...:.|          ||
Zfish     1 MRLRGRDLEDSTVSWIPSVLGVQSVRLRLRLDRRDDRGRSLWQLVDLGEEVQS----------GR 55

  Fly  1022 -----------QQLIVPP----------DYQKSAFIWDDYISEVGGMAASKELFTP---RQPMEY 1062
                       |.|:..|          :.|....|...::....|....::...|   |.| ||
Zfish    56 RPRDRTPPTCSQSLMSIPAAPSVQSGGGEMQSPGVISPSFLPPASGKVPGRKRGRPPLKRHP-EY 119

  Fly  1063 QERMKLEVVDQRNPCLIRPATVVTRKG--------YRVQLHLDCWPTEYYFWLEDDSPDLHPIGW 1119
            |.|.         |..:.|..|..::|        .|:...|...|..     ....||:..|..
Zfish   120 QSRY---------PESLPPIKVPKKRGRKPGFKLKSRLMTPLAISPPS-----STPEPDMSSIPQ 170

  Fly  1120 CEATSHELETP---------------------------PGYL---QPKSVMPCDVEGC------- 1147
            ..||.....||                           |.:|   :|..|:...|:||       
Zfish   171 DAATIPHSATPQVLTVCIYVNKQVNTGPNLDRQKVLQLPDHLGPARPSVVLQQAVQGCIDSAFQQ 235

  Fly  1148 --------RGFGNAK---RFNLNVHA---------------LRECC------------PYAP--- 1171
                    .|:|..|   .|:...|.               |::.|            |.||   
Zfish   236 KAVFTLLTEGYGGEKISATFDGKQHLLSLPVVNSVGYVLRFLKKLCRSLLCENLFSDQPIAPSSS 300

  Fly  1172 ---------ENWRQWRSK-----------TVKPPRVAPENIRRGWAKKTKRACSEAKQAIKEDSQ 1216
                     |.....:||           :|:|.|.:.:....| |..:..|.|:.....:..|.
Zfish   301 PSSSSSFHMEKHSDGQSKSNSMVDDYHGDSVEPKRYSVDPSDFG-AMSSPYAASKPAYGFRSASA 364

  Fly  1217 ------QEIVYPKV-AEVVQAKRKTSPCEEKVVKKQKQMQKEEDAEQV-------PDERSLAIAR 1267
                  ::...|.. .|..::....||                ||.:|       |...|:....
Zfish   365 YSGGICRQAASPSTFPEGNRSAYSPSP----------------DAGEVKPPPSKDPSRWSVDEVV 413

  Fly  1268 SFVKDYGPQFL-PNYRLWQLNSAFKLDDVRTNPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDG 1331
            .|:||..||.| |:..|::                                        :.:|||
Zfish   414 WFIKDADPQALGPHVELFR----------------------------------------KHEIDG 438

  Fly  1332 RALLMLGRKELDTYLKLKVGPAVKL 1356
            .|||:|....:..||.||:|||:||
Zfish   439 DALLLLKSDMIMKYLGLKLGPALKL 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723 18/81 (22%)
MBT 1038..1130 CDD:214723 20/102 (20%)
SAM_PNT 1279..1366 CDD:280377 18/78 (23%)
scml4XP_001332433.4 DUF3588 185..293 CDD:288954 14/107 (13%)
SAM_Scm 401..472 CDD:188977 26/103 (25%)
SAM 404..472 CDD:197735 26/100 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583959
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.