DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)mbt and Samd13

DIOPT Version :10

Sequence 1:NP_733209.1 Gene:l(3)mbt / 43288 FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_083420.2 Gene:Samd13 / 75015 MGIID:2686498 Length:234 Species:Mus musculus


Alignment Length:63 Identity:19/63 - (30%)
Similarity:23/63 - (36%) Gaps:26/63 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly  1168 PYAPENWRQWR-----SKTVKPPRVAP----ENIR----------------RGWAKKTKRACS 1205
            ||..:...::|     ||||...||..    ||||                ||| |..:..||
Mouse   173 PYISQGMGKFRLVTTCSKTVNGKRVVTKRVVENIRGPKKIENERLFRHNPSRGW-KLMENPCS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 PRK10819 <332..>427 CDD:236768
MBT_L3MBTL1-like_rpt1 846..945 CDD:439091
MBT_L3MBTL1-like_rpt2 957..1045 CDD:439092
MBT_L3MBTL1-like_rpt3 1058..1130 CDD:439093
SAM_PNT 1278..1367 CDD:460486
Samd13NP_083420.2 DnaJ 3..66 CDD:395170
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.