Sequence 1: | NP_733209.1 | Gene: | l(3)mbt / 43288 | FlyBaseID: | FBgn0002441 | Length: | 1477 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001074884.1 | Gene: | Samd1 / 666704 | MGIID: | 2142433 | Length: | 519 | Species: | Mus musculus |
Alignment Length: | 320 | Identity: | 68/320 - (21%) |
---|---|---|---|
Similarity: | 113/320 - (35%) | Gaps: | 106/320 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 1122 ATSHELETPPGYLQPKSVMPCDVEGCRGFGNAKRFNLNVHALRECCPY----APENWRQWRSKTV 1182
Fly 1183 KPPRVAPENIRRGWAKKTKRACSEAKQAIKEDSQQEIVYPKVAEVVQAKRKTSPCEEKVVKKQKQ 1247
Fly 1248 MQKEEDAE----------QVPD--------------ERSLAIARSFVKDYGP------------- 1275
Fly 1276 -------QFLPNYRLWQLN--------------------------------SAFKLDDVR----T 1297
Fly 1298 NPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKLY 1357 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
l(3)mbt | NP_733209.1 | MBT | 822..918 | CDD:214723 | |
MBT | 929..1028 | CDD:214723 | |||
MBT | 1038..1130 | CDD:214723 | 1/7 (14%) | ||
SAM_PNT | 1279..1366 | CDD:280377 | 29/115 (25%) | ||
Samd1 | NP_001074884.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..30 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 87..232 | 9/40 (23%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 261..381 | 22/125 (18%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 417..439 | 2/21 (10%) | |||
SAM_Atherin-like | 440..508 | CDD:188982 | 24/59 (41%) | ||
SAM | 440..506 | CDD:197735 | 24/59 (41%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |