DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)mbt and SCML1

DIOPT Version :9

Sequence 1:NP_733209.1 Gene:l(3)mbt / 43288 FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_005274635.1 Gene:SCML1 / 6322 HGNCID:10580 Length:330 Species:Homo sapiens


Alignment Length:225 Identity:51/225 - (22%)
Similarity:86/225 - (38%) Gaps:58/225 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1193 RRGWAKKTKRACSEAK-QAIKEDSQQE-IVYPKVAE---VVQAKRKTSP--------CEEKVVKK 1244
            |.|:.|.:.|...:.| |.:|::...| ..||:...   .|..:...||        |.|    :
Human   104 RYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCME----E 164

  Fly  1245 QKQMQKEED-------AEQVPDERSLAIARSFVKDYGPQF-------LPNYRLWQLNSAFKLD-- 1293
            .::.:.|||       :...|.:.|....:.:....|..:       |.|.|...:::.:..|  
Human   165 YQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYSTDHA 229

  Fly  1294 -----DVRTNPL-------------HWTSWDVCEYIERALDSTD------IAKVIFEQDIDGRAL 1334
                 .|..:|:             |.::|.| |.:...|..||      :..:....:|||:||
Human   230 SAAPPSVTRSPVENDGYIEEGSITKHPSTWSV-EAVVLFLKQTDPLALCPLVDLFRSHEIDGKAL 293

  Fly  1335 LMLGRKELDTYLKLKVGPAVKLYSLILNLR 1364
            |:|....|..:|.:|:|.||||...|..|:
Human   294 LLLTSDVLLKHLGVKLGTAVKLCYYIDRLK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377 29/112 (26%)
SCML1XP_005274635.1 SAM_Scm 253..324 CDD:188977 24/72 (33%)
SAM 256..324 CDD:197735 23/69 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149829
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.